KEGG   Acinetobacter baumannii ATCC 17978: A1S_2825Help
Entry
A1S_2825          CDS       T00486                                 

Definition
thiol:disulfide interchange protein (DsbC-like)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
acb  Acinetobacter baumannii ATCC 17978
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3270940..3271407
Genome map
AA seq 155 aa AA seqDB search
MTEERIAELGKIDVKSLPLNQAIKYVKGKGERTLYIFSDPDCPYCQRLEQNMVGVDNVTV
YVFLYPLTSLHPNAEKVSNQIWCSKNPSEAWTNYMLNRKLPAAGKSCTSPIQKNIALGQK
LNIDGTPTLFLQDGQRISGVPSDAKQIEALLQSVK
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgacagaagagcgaattgccgaattgggtaaaattgatgttaaaagtcttccattaaat
caggcaattaaatacgtcaaaggtaaaggagaacgtactctttatattttcagtgaccct
gattgcccttactgccagcgtctagaacaaaatatggttggggtggataacgtaacggta
tatgtattcttatatccgctgaccagcttacatccaaatgctgaaaaggtttctaatcaa
atctggtgctctaaaaacccttcagaagcttggacaaattatatgcttaaccgtaaattg
ccagcggctggcaaaagctgtacaagtccaattcagaaaaatattgctttaggccagaaa
ttaaatatagatggcacaccaactctgttcttacaagatggtcaaagaatctctggcgta
ccaagtgatgcaaaacagattgaagcattattacagtcagtaaaataa

DBGET integrated database retrieval system