KEGG   Acinetobacter baumannii ATCC 17978: A1S_2831Help
Entry
A1S_2831          CDS       T00486                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:acb03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3277733..3278359
Genome map
AA seq 208 aa AA seqDB search
MLWHLGMSGSFRLCQPNDELRKHDHLIIQFEDQQLRYHDPRRFGCILWLNPETQGKLIDT
LGPEPLSTDFHAEYLASKLKNKSVGIKIALMDNHVVVGVGNIYATESLFNVGIHPAQPAG
DLTMQQIEKLVVEIKRILKSAIDLGGSTLRDYSNAMGENGYFQQTLLAYGRAGEMCVNCE
TTLENLKLGQRASVFCPQCQPLKKLRKP
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgctctggcatttaggaatgtcgggtagctttcgcctgtgtcaaccaaacgatgaattg
agaaaacacgatcatctcattattcaatttgaagatcagcagttacgttaccatgaccca
cgtcgttttggctgtattctttggcttaaccctgaaactcaaggcaaactcatcgatact
ttaggaccagagcctttaagtactgactttcatgcagaatatttagcttctaaactcaag
aataaatctgtcggcataaaaattgcactcatggataatcatgtagtggttggtgttggc
aatatctatgcaactgaaagcttgtttaatgttggcattcatccagcacagcccgctggt
gatttaaccatgcaacagattgagaaactggttgttgagattaagcgaattttgaagtca
gcaattgatttaggcggctcgactttacgagactacagcaatgccatgggtgaaaatggt
tattttcaacagactttactcgcttatggtcgtgccggagaaatgtgtgttaactgtgaa
accacattagaaaacttaaaactcggtcagcgtgccagcgtattttgcccacagtgccaa
ccacttaaaaagctgagaaagccttaa

DBGET integrated database retrieval system