KEGG   Acinetobacter baumannii ATCC 17978: A1S_2831Help
Entry
A1S_2831          CDS       T00486                                 

Definition
(GenBank) formamidopyrimidine-DNA glycosylase
  KO
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:acb00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    A1S_2831
Enzymes [BR:acb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     A1S_2831
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     A1S_2831
DNA repair and recombination proteins [BR:acb03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     A1S_2831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
3277535..3278359
Genome map
AA seq 274 aa AA seqDB search
MPELPEVETTKTSLFPLLNQKVLSVEVRNPSLRWPIPDNVQKLVGQRLIGLNRRSKYILA
EFEQDQMLWHLGMSGSFRLCQPNDELRKHDHLIIQFEDQQLRYHDPRRFGCILWLNPETQ
GKLIDTLGPEPLSTDFHAEYLASKLKNKSVGIKIALMDNHVVVGVGNIYATESLFNVGIH
PAQPAGDLTMQQIEKLVVEIKRILKSAIDLGGSTLRDYSNAMGENGYFQQTLLAYGRAGE
MCVNCETTLENLKLGQRASVFCPQCQPLKKLRKP
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagttacccgaagtcgaaaccaccaaaaccagtttatttccattattgaatcaa
aaagttctaagtgttgaagtacgcaatcctagcttacgctggcctataccagataatgtt
cagaaacttgttggacaacgtctcattgggttaaatcgacgttcaaaatatattttggca
gagtttgaacaagatcaaatgctctggcatttaggaatgtcgggtagctttcgcctgtgt
caaccaaacgatgaattgagaaaacacgatcatctcattattcaatttgaagatcagcag
ttacgttaccatgacccacgtcgttttggctgtattctttggcttaaccctgaaactcaa
ggcaaactcatcgatactttaggaccagagcctttaagtactgactttcatgcagaatat
ttagcttctaaactcaagaataaatctgtcggcataaaaattgcactcatggataatcat
gtagtggttggtgttggcaatatctatgcaactgaaagcttgtttaatgttggcattcat
ccagcacagcccgctggtgatttaaccatgcaacagattgagaaactggttgttgagatt
aagcgaattttgaagtcagcaattgatttaggcggctcgactttacgagactacagcaat
gccatgggtgaaaatggttattttcaacagactttactcgcttatggtcgtgccggagaa
atgtgtgttaactgtgaaaccacattagaaaacttaaaactcggtcagcgtgccagcgta
ttttgcccacagtgccaaccacttaaaaagctgagaaagccttaa

DBGET integrated database retrieval system