KEGG   Acinetobacter baumannii ATCC 17978: A1S_2875Help
Entry
A1S_2875          CDS       T00486                                 

Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
acb00260  Glycine, serine and threonine metabolism
acb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
acb01100  Metabolic pathways
acb01110  Biosynthesis of secondary metabolites
acb01130  Biosynthesis of antibiotics
acb01230  Biosynthesis of amino acids
Module
acb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:acb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A1S_2875
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A1S_2875
Enzymes [BR:acb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     A1S_2875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABO13281
Position
complement(3323203..3324432)
Genome map
AA seq 409 aa AA seqDB search
MDQQNNVIDYTQFPDANGHFGIHGGRFVSETLMAALEDLENLYSRMKNDEQFLAEFDRDL
AYYVGRPSPLYYAERWSKELGGAQIYLKREDLNHTGSHKVNNTIGQALLAKLSGKKRIIA
ETGAGQHGVATATIAARLGLECVVYMGAEDVKRQAMNVYRMRLLGATVVPVQSGSKTLKD
AMNEAMRDWVTNVDTTYYVIGTVAGPHPYPQLVRDFQSIIGREARKQILEQAGRLPDALV
ACVGGGSNAMGLFYPFLNDASVKMYGVEAAGFGIETGKHSAPLNAGHVGVLHGNRTYLMS
DEQGQIIETHSISAGLDYPGVGPEHSFLKDMKRVEYVPINDTEALQGFRDLTKIEGIIPA
LESSHAMAYVSKLAPTMSKDQIIIATVSGRGDKDLMTVARIDGVEMVEM
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtggatcagcaaaataatgtgattgactatacccaattcccagatgcaaatgggcatttc
ggtatccatggcggacgttttgtgtcagaaactttaatggcggcattagaagatttggaa
aatctctattcccgcatgaaaaatgatgaacagtttttggcagaattcgaccgtgacctc
gcctactatgtaggtcgtcctagtccactttattatgctgaacgatggtcaaaagagtta
ggtggtgcgcaaatttaccttaaacgtgaagacttgaaccatacaggctcacacaaggta
aacaacacgattggtcaggcactacttgcaaagctttctggtaaaaaacgtattattgcc
gaaactggtgcagggcagcatggtgtagcaacagcaacaattgcagcacgtttaggtctt
gaatgtgttgtttatatgggtgctgaagacgttaagcgtcaagcgatgaacgtttaccgt
atgcgtttgttgggtgcaacagttgtgcctgtgcaaagtggctctaaaacattaaaagat
gccatgaatgaagcgatgcgtgactgggtaaccaacgttgatacgacttactatgtcatt
ggtacagttgcaggtccgcatccttatcctcaacttgttcgtgacttccagtcaattatt
ggtcgtgaagcgcgtaaacagattttggaacaagcaggtcgcttaccagatgcattagtt
gcttgtgtaggtggtggttcaaatgcaatgggcttgttctatccgttcttaaacgatgcc
agtgtaaaaatgtatggtgttgaagccgctggttttggtattgaaactggtaaacactct
gcgccgttaaatgcgggccatgtgggtgtattgcatggtaaccgtacttacttgatgagt
gatgaacaaggtcagattattgagacacatagtatctcggcgggccttgattatccgggt
gttggtcctgaacatagcttcttgaaagatatgaagcgtgtagagtacgtgccgattaat
gatacagaggctcttcaaggtttccgtgacttaaccaaaatcgaagggattattcctgcg
cttgaaagctcgcacgcgatggcgtatgtctctaagcttgcaccgacgatgtctaaagat
cagattattattgcgactgtttcaggccgtggcgataaagacttaatgacagttgcacgc
attgatggcgtagaaatggtcgagatgtaa

DBGET integrated database retrieval system