KEGG   Acinetobacter baumannii ATCC 17978: A1S_2976Help
Entry
A1S_2976          CDS       T00486                                 

Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
acb  Acinetobacter baumannii ATCC 17978
Brite
Enzymes [BR:acb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     A1S_2976
Secretion system [BR:acb02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   A1S_2976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3467120..3467683)
Genome map
AA seq 187 aa AA seqDB search
MPGLYSANLDQQIIYLGEDGQHMFVGSMIRLKDQKNLTKDLVLGQNSIDWKQLPLKDAIK
TVKGNGQHVLAVFSDPNCPYCKQLEPELDKLKDVTIYTFIYPLKPQSIVVSRQVWCAPNQ
SYSWKKLIEQGVKPMVASCTNPIDRNLELGKKLGFNGTPTLIFANGFKLVGARSAEEIQA
VWKELGL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgcctggactatatagtgctaatctggaccagcaaattatttatcttggtgaagatggg
cagcacatgtttgtaggctctatgattcggttaaaagaccaaaagaacttaactaaagat
ctggttttaggacagaactcaattgattggaaacagttgcctttaaaagatgctattaaa
acagtcaaaggtaatggtcagcatgttttagcagtattttctgatccaaattgcccttat
tgtaagcagcttgaacctgaactcgacaagcttaaagatgtcactatttacacttttatc
tatcctttaaaacctcagtctattgtggtttctagacaagtttggtgtgcaccgaatcaa
tcatattcatggaaaaaattaattgagcaaggtgttaaaccaatggttgcgagctgtaca
aacccgattgaccgtaacttggaattagggaaaaaattaggttttaatggcacacctact
ctcatttttgctaacggatttaaactcgtcggagcgcgctctgctgaagaaattcaggca
gtttggaaagagttaggtttataa

DBGET integrated database retrieval system