KEGG   Acinetobacter baumannii ATCC 17978: A1S_3203Help
Entry
A1S_3203          CDS       T00486                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate-2 6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:acb00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:acb00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3688799..3690043)
Genome map
AA seq 414 aa AA seqDB search
MGEWQKRYLQQADVVKPLRIIAVTGTNGKTTISRLIAELISSQQQRCAVMGTTGNGILPN
LTPSTHTTLDALQLQNALHDYAKQGATFASLEASSHGLEQGRLNGCDIEIAVYSNLSRDH
LDYHGTLEAYAEAKARLFQFNSLKVAVINLDDAHADLMIKSAQNNPAQPKILTYSLTQNT
ADYYITDLSYSLAGATFNLVSQQGSFAVESPLLGHFNVENLIAALIAAEQAGFDLQALVN
FVPKLIGAPGRMQVIRDDERLFVVDYAHTPDALIQVLKTLKRHVSNQLWAVFGCGGDRDR
GKRPLMTQAALDGANPVILTSDNPRTEDPEQIFADMKQGIDFSGHRMHEIHDRREAIKFV
AEQAQAGDIVVIAGKGHENYQEINGVRHWFDDVVEVRSAIDAQHHTVDAAYPAQ
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgggagagtggcaaaaacgttatttgcaacaggctgatgtagtaaaacctttacggatt
atagctgtaacaggcacaaatggtaaaacaacaatttctcgtttaattgctgagttaatt
agttcacaacagcagcgctgtgcagtgatggggacaacagggaatggtattttacctaac
ttaacgccttctacgcatactaccctcgacgctctacagttacaaaatgcgctacatgat
tatgctaaacagggagcaacttttgcttctttagaagcaagttcacatggtcttgaacag
ggtcgattaaatggttgcgatattgaaattgctgtttatagcaacttaagtcgtgaccat
ctggattatcatggcactttagaagcttatgcagaagcgaaggcgcgtttatttcagttt
aattcgttaaaagtcgctgttattaatttagatgatgcgcatgctgacttgatgattaag
tctgcccaaaataatccagcacaacctaaaattttgacttactcactaactcaaaataca
gctgattattacattaccgatttaagctatagcttggcgggtgcaacttttaatttagta
agtcagcaaggttcatttgcggtagaaagtccattattaggtcatttcaatgttgaaaat
ttaattgccgcactcatcgctgctgagcaagctggtttcgatttacaggcattggttaat
tttgttcctaaactaattggtgcgccaggccgaatgcaagttattcgtgatgatgagcga
ttatttgtagtggattatgcgcatacaccagatgcattgattcaagtgcttaaaacatta
aagcgtcatgtttcgaatcagctttgggcggtgtttggatgtggtggtgaccgtgaccgt
ggtaagcgtccactcatgactcaagcagctttggatggcgcaaatcctgttattctgact
tcagataatccaagaacagaagaccctgaacaaatttttgctgacatgaagcaaggaatc
gatttttcagggcatcgtatgcatgaaattcatgaccgccgtgaagcaattaaatttgtt
gcagagcaagctcaagctggtgacattgtagtgattgccggcaaaggacatgaaaattat
caagaaattaatggtgtgcgtcactggtttgatgatgtggttgaagtgcgttccgcgatt
gatgcccaacatcatacggtagatgctgcttaccctgcacaatag

DBGET integrated database retrieval system