KEGG   Acinetobacter baumannii ATCC 17978: A1S_3422Help
Entry
A1S_3422          CDS       T00486                                 

Definition
(GenBank) hypothetical protein
  KO
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    A1S_3422
Enzymes [BR:acb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     A1S_3422
    3.5.1.-  
     A1S_3422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3933525..3934163)
Genome map
AA seq 212 aa AA seqDB search
MNKQPQNSALVVVDVQNGFTPGGNLAVADADTIIPTINQLAGCFENVVLTQDWHPDNHIS
FAANHPGKQPFETIELDYGSQVLWPKHCIQGTHDAEFHPDLNIPTAQLIIRKGFHAHIDS
YSAFMEADHTTMTGLTGYLKERGIDTVYVVGIATDFCVAWTALDAVKQGFKTLVIEDACK
GIDLNGSLEQAWQTMQQQGVVRIQSTDLLNEC
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacaaccacaaaattcggctttagtcgtagttgacgtgcaaaatggttttacc
cctggtggaaacctagcagttgccgacgctgatacgattattccaaccattaaccaattg
gcaggttgttttgaaaatgtagtcctcactcaagactggcatccggataatcacatttct
tttgcagccaaccatccgggcaagcagccatttgaaacgattgaactggattatggatca
caggtgctttggcctaagcattgtatacaaggcactcatgatgccgaatttcatccggat
ttaaatatcccgacagctcaactgattatccgaaaaggttttcatgctcatattgatagt
tactcggcttttatggaagctgaccacaccacaatgacaggtttaacgggttacttaaaa
gaacgtggtattgatacggtctatgtggtcggaattgctacagacttttgtgtcgcatgg
actgctttagatgcggttaagcaaggctttaaaactttagtaattgaagatgcatgcaaa
ggtattgatcttaatggttcattagaacaagcgtggcaaactatgcagcaacaaggtgtt
gttcgtattcaatcgactgatctgttgaatgaatgctag

DBGET integrated database retrieval system