KEGG   Acinetobacter calcoaceticus: BDGL_000151Help
Entry
BDGL_000151       CDS       T01684                                 

Gene name
algC
Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
acc  Acinetobacter calcoaceticus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:acc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BDGL_000151 (algC)
   00030 Pentose phosphate pathway
    BDGL_000151 (algC)
   00051 Fructose and mannose metabolism
    BDGL_000151 (algC)
   00052 Galactose metabolism
    BDGL_000151 (algC)
   00500 Starch and sucrose metabolism
    BDGL_000151 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    BDGL_000151 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    BDGL_000151 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BDGL_000151 (algC)
Enzymes [BR:acc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     BDGL_000151 (algC)
    5.4.2.8  phosphomannomutase
     BDGL_000151 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
158975..160393
Genome map
AA seq 472 aa AA seqDB search
MNVRHSFPKSIFRAYDIRGKLSYLTTDVVRSIAYGLAQQYKQVKQTQLVIGYDARLTSPA
YAYLIEEILIEQGLNVTNIGCCSSPMMYYIARDFGGNGIMVTASHNPKSDNGIKWILKGE
PPSPEMIQQVGEEAQTYVPNHSISVLELTLPQFKAEFCQQYQQAIFKDIQLKRPLKVVLD
GLHGSAGHCSKLILEKMGCEVIALRTNPNGEFPDHAPDPSHAAHLISLRKAVVEQQADIG
IALDGDGDRVVLVDEKAQILTADRLLSLFAQMCLEQHPEQEIVFDVKCSRMVQETVEKLG
GKAKMIRTGSSFLRAYLSQSNGRAIFGGEYAGHYVFNDGRGFGYDDGLYAALRVMEYFTQ
SSATTISELFAPYPERCCTEDTYIGTYQSDPKYVLQDIEILSHRLGARISKIDGVRLDFD
DGFGIIRASNTGEYFTVRFDADNPLRLKEIQQKFVDMLQEHYPQIAQELSEA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaagacactcatttccaaaaagtatttttcgtgcttacgatattagaggcaaa
ctttcttacttaaccacggacgttgtccgttcaattgcctacggattggcacaacaatac
aaacaagtaaaacaaactcaattagtgattggctatgatgcccgtctcactagcccagct
tatgcgtacttaattgaagaaattttaatagaacaaggcctaaatgttaccaatatcggc
tgctgttcatcacctatgatgtactacattgcacgagattttggtggcaatggcattatg
gtgaccgcaagtcataatccaaaatctgacaatggtattaagtggattttaaagggtgaa
ccgccgtctccagaaatgattcagcaggtgggtgaagaagcccaaacttatgtaccaaac
cattcaatttctgtacttgagttgacattaccgcaatttaaagctgaattttgccagcaa
taccaacaagccatttttaaagatattcagttaaaacgtcctttaaaagttgttttagat
ggtttgcatggttcagccgggcattgttcaaaactaatcttagaaaaaatgggttgtgaa
gtcatagctttacgcactaatccaaatggagagtttccagatcacgcaccagatccatca
catgcagctcatttaattagcttgcgaaaagccgtggtcgagcagcaggcggatattggt
attgctttggatggtgatggagaccgtgttgttttagttgatgaaaaagcacagatattg
acagcagaccgcttattgtcgctttttgcgcaaatgtgccttgagcagcacccagagcaa
gaaattgtttttgatgtgaaatgttcacgtatggttcaagagaccgtcgagaaactcggc
ggaaaagcaaaaatgatccgcacgggaagtagtttcctaagagcttatttatctcaatcg
aatggccgtgccatttttggtggagaatatgcaggtcattatgtgtttaatgatggccgt
ggttttggctacgacgatggtttatatgctgcattacgagtaatggagtattttacccaa
tcgagtgctacaacaatttctgaattatttgctccatatccagaaagatgttgtacagaa
gatacctatattggtacttatcagtctgatccaaagtatgtattacaagatattgagatt
ttaagtcatcgcttaggggcacgtattagtaaaattgatggcgtacgtcttgattttgat
gatggttttggcattattcgagcatcaaatactggtgaatactttacagtacgatttgat
gcagataatcctttacgattaaaggaaatccagcaaaaatttgtggatatgttgcaagaa
cactatccgcaaattgcacaagaactttcagaggcctaa

DBGET integrated database retrieval system