KEGG   Acinetobacter pittii: BDGL_000171Help
Entry
BDGL_000171       CDS       T01684                                 

Gene name
hemB
Definition
(RefSeq) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
acc  Acinetobacter pittii
Pathway
acc00860  Porphyrin and chlorophyll metabolism
acc01100  Metabolic pathways
acc01110  Biosynthesis of secondary metabolites
acc01120  Microbial metabolism in diverse environments
Module
acc_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:acc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BDGL_000171 (hemB)
Enzymes [BR:acc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     BDGL_000171 (hemB)
Exosome [BR:acc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BDGL_000171 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-GeneID: 11638347
NCBI-ProteinID: YP_004994439
UniProt: F0KFN7
Position
complement(178611..179624)
Genome map
AA seq 337 aa AA seqDB search
MTYTFNRPAFPATRMRRIRKNDQLRAMVSETQLTTNHLIYPVFVLPGQNQTQDIPSMPNI
QRLSADLLLKKAERLLELGVSKLALFPVTPQEDKSLTAEAAWHEDGLVQTTCRLLKKELP
EMVLITDGALDPYTTHGQDGIIDETGYVLNDETVECLIKQALSHAEAGAEVIAPSDMMDG
RIGAIRQALEANGHIYTNIMAYSAKYASSFYGPFRDAVGSASNLKGGNKYNYQMDFANRA
EALHEIALDIQEGADMVIVKPGMPYLDVVREVKDTFGIPTFIYQVSGEYAMLAGAIQNGW
LSDSVILESLMCCRRAGADGIWTYFAETAAEKLKEMN
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgacttatacgttcaatcgtcctgcatttccagccactcgcatgcgccgtatccgtaaa
aatgaccagttgcgtgcgatggtcagcgaaacacagctcactaccaatcacttgatttat
ccagtatttgtattaccgggacaaaatcagacccaagatattccaagtatgccaaacatt
cagcgtttgtcggcagatttgttactgaaaaaagctgaaagacttctggaattgggtgta
tcaaaactggctctttttccagttaccccgcaagaagataaaagcctcaccgcagaagct
gcatggcatgaagatggtttagtacaaaccacatgtcgtctgcttaaaaaagaattacca
gaaatggtgttaattactgatggtgccctcgatccatacaccacgcatggtcaagacggc
attattgatgaaactggctatgtgctgaatgacgagactgtagaatgcttgattaaacaa
gcgttaagtcacgcagaagctggtgccgaagtgattgcaccaagtgacatgatggatggc
cgcattggcgcaattcgtcaggctttagaagctaatggtcacatctataccaacatcatg
gcctactctgcgaaatatgcatctagcttctatggcccgttccgtgatgctgttggctct
gcatccaacctaaaaggtggtaataaatataactaccagatggactttgccaaccgtgcc
gaagcgttacatgaaatcgcgcttgatattcaagaaggcgccgacatggtgattgtaaaa
ccgggcatgccatatctggatgtggtacgtgaagtgaaagatacctttggtattccgaca
ttcatttaccaagtgagtggtgaatatgcaatgttagccggcgcaattcaaaatggctgg
ttgtcagattcagtcattttagaatcactgatgtgctgccgccgcgcaggtgcagacggg
atctggacttactttgcagaaaccgctgctgaaaaactcaaggaaatgaactaa

DBGET integrated database retrieval system