KEGG   Acinetobacter calcoaceticus: BDGL_000243Help
Entry
BDGL_000243       CDS       T01684                                 

Gene name
mro
Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
acc  Acinetobacter calcoaceticus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:acc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BDGL_000243 (mro)
   00052 Galactose metabolism
    BDGL_000243 (mro)
Enzymes [BR:acc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     BDGL_000243 (mro)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(260102..261247)
Genome map
AA seq 381 aa AA seqDB search
MKKLVILGVTIYSVAQLANAATINVKPYGTTQDGQKVDLYTMSNNKGVSVSFISFGGVIT
QILTPDAQGKQNNIVLGFDDLKGYEVTDTKEGIHFGGLIGRYANRIGNAKFSLDGKTYNL
EKNNGPNSLHSGNPGFDKRVWQVKPLVSKGETVKASLKLTSPNGDQGFPGKLDVEVIYSL
SDQNEFQIEYQAKTDQPTVVNLTNHSYFNLSGAGNNPYGVLDHVVQLNADRILITDQNSL
PTGEIASVAGTPFDFRTPKTIAKDIRANNQQLAYGYGYDQTWVINQKSQGKLNLAAVVVD
PKSKRTMQVLTTEPSVQMYTANHLLGNIVGANGVLYRQADALALETQHFPDSPNQPAFPS
TRLNPNQTYNSVTVFKFGIQK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattagtaattttaggtgttacgatttatagcgttgcacaacttgcaaatgca
gcaacgataaatgtaaagccatatggcacaactcaagatggtcaaaaagttgatctatac
accatgagcaataacaaaggagtctcagtttcttttattagcttcgggggtgtaattaca
caaattttgactcccgatgcccaaggtaaacaaaataatatcgttttaggttttgatgat
ctaaaaggctatgaagtcactgatactaaggaaggtattcattttggcggattaattggt
cgttatgcgaaccggattggtaatgctaaatttagcttagatggaaaaacgtataacctt
gaaaaaaataatgggccgaattcattacatagcggcaatcctggttttgataaacgtgta
tggcaagttaagcctctggtttctaaaggtgaaaccgttaaagcgtctctgaagttaacc
agtccaaatggtgatcaaggatttcccggaaaattagatgtagaagtgatctacagtctt
tcagatcaaaatgaattccagattgaatatcaagccaaaactgatcaaccgacagtcgtc
aatctcaccaaccacagttatttcaacttatcaggcgctggcaataatccttatggcgta
ctagatcatgtggtacaactcaatgcagaccgtatattgataaccgatcaaaactcttta
cccacaggtgaaatagcttcggttgcaggtacaccttttgattttcggacacctaagacg
attgcgaaagatattcgagcgaataatcagcaattggcctatggatatggctatgaccaa
acttgggtaattaatcaaaagtctcaagggaaactcaatcttgcggctgttgtagttgat
ccaaaatctaaacggaccatgcaggttttaactactgaaccaagcgttcaaatgtataca
gccaatcatttattaggaaatattgttggcgcaaatggtgtgctctatcgacaagcagac
gcactagcattagaaacacagcattttccagatagcccaaatcaaccggctttcccatcc
actcgtttaaacccaaatcaaacttataacagtgtcaccgtatttaagtttggtattcaa
aaatag

DBGET integrated database retrieval system