KEGG   Acinetobacter calcoaceticus: BDGL_000403Help
Entry
BDGL_000403       CDS       T01684                                 

Gene name
choB
Definition
FAD dependent oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
acc  Acinetobacter calcoaceticus
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(440278..441948)
Genome map
AA seq 556 aa AA seqDB search
MTTNNYDYDYLIIGSGFGGSVSACRLTEKGYSVAVMEMGRRWEAKDFAKNNWNTRRWIWR
PGMKLFGYFNMRFFRHVTIICGNAVGGGSITYANTLLVPPEHIWDEGTWADAADWKNEMP
QHYAEAERMLGVTDNKIFGPADHMLKKMGDAVGVGHTFKPTRVATFFPPEGEEGGKTYPD
PYFNGDGPDRGTCTACGGCMTGCKHNAKNTLDKNYLYFAEKNGAKVYEETKVVDVKPLNG
KADGSDGYEVTTECSSSWFNKQRRTWRVRNVIFSASSLGTQEMLFRLKQSGSLPNISDDL
GNRVRTNAESILGVRFFGKDVDMSKGVAIGSSIYIDHDTHIEATRYQTGSDAMGLMCTYM
AKGKPGWTRIFFWLWALICHPFIFLRMSNPVSFARQTLIFLVMQTADASINMRLKRNWFW
PFGKVLSSEGKKLPVYIPQANAFTEKVAKMFNGHPMTTITEILFNVPFTAHCMGGCAIAS
SPERGVVDGQNRVFNYKNLYVVDGSMLGANLGVNPSLTITALAERAMSYIPAKHTLDEQQ
GYRADAETIEITKASA
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaaacaattatgactatgattacctcattattggttcaggctttggtggtagt
gtttctgcttgccgtctaaccgaaaaaggctactctgttgctgtaatggaaatggggcga
cgctgggaagctaaagattttgctaaaaataactggaatacccgtcgctggatttggcgc
ccgggcatgaaactttttggttatttcaacatgcgtttttttcgccatgtcaccattatt
tgcggtaatgctgtaggtggcggttcaatcacctatgccaataccttactggttccacct
gaacatatttgggatgaaggcacatgggcagatgcagcggactggaaaaatgaaatgcca
cagcactatgctgaagcagaacgcatgcttggagtgactgataataaaattttcggtcct
gccgaccacatgctaaaaaaaatgggcgatgcagttggggttggacacacatttaagccc
actcgtgttgcaacgttctttccacccgaaggtgaagaaggtggcaagacctatcctgac
ccgtactttaacggcgatggtccagaccgcggaacctgtaccgcatgtggcggctgtatg
acaggttgtaaacacaacgcaaaaaatacattagataaaaactatttgtattttgccgaa
aaaaatggtgccaaggtttacgaagaaaccaaagttgttgatgttaaaccgctcaatggc
aaagccgatggcagcgatggctatgaagttacgactgaatgttcgagctcatggtttaac
aaacaacgtcgtacatggcgtgttcgtaacgtgattttctctgcatcttctttgggaacc
caagaaatgttgttccgtttaaaacaatcaggttctctgccaaatatttctgatgatttg
ggtaatcgcgttcgtactaatgccgagtcgattttaggtgttcgcttttttggtaaagat
gtcgacatgagtaaaggtgttgccattggttcaagtatttacatcgaccatgacactcac
attgaagcgactcgttaccaaactggttcagatgccatgggcctcatgtgtacttacatg
gctaaaggtaaaccgggttggacgcgtatcttcttttggttatgggcacttatttgccat
ccatttattttccttcgcatgagtaatcctgtcagttttgcgcgtcagactttaattttc
ttggtgatgcaaaccgcagatgcctcaatcaacatgcgcttgaaacgtaattggttctgg
ccttttggcaaggtgttatcgagcgaaggtaaaaagctacctgtgtatattccgcaggcc
aatgcatttaccgaaaaagtcgcaaaaatgtttaatggtcacccaatgacgaccattacc
gaaattttatttaacgtgccttttacagctcactgtatgggtggttgtgcaattgcttca
agtccagagcgtggcgtagtagatggacaaaaccgtgtctttaactataaaaacttatac
gttgtagatggttcaatgttaggtgccaatttaggcgttaacccaagtctcaccattaca
gctcttgcagaacgtgccatgtcgtatattccggctaaacatactttggatgagcaacaa
ggttatagagcagatgcagaaaccatagagatcaccaaagcttctgcctaa

DBGET integrated database retrieval system