KEGG   Acinetobacter calcoaceticus: BDGL_000851Help
Entry
BDGL_000851       CDS       T01684                                 

Gene name
gpo
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
acc  Acinetobacter calcoaceticus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:acc00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:acc00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
903365..903850
Genome map
AA seq 161 aa AA seqDB search
MSNIYQFEAELLEGEVKQLADYKGKVLLIVNTASKCGFTPQFAGLEKLYEKYKDQGLEVL
GFPCNQFGGQDPGSNKEIGSFCQRNYGVKFPMFAKVDVKGPEAHVIFRYLTREAKGILGS
SSIKWNFTKFLVGKDGAVLNRYAPTTKPEALEADIEKALAS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatatttatcagtttgaagctgagctgttagagggtgaagttaagcaattagct
gattataaaggtaaagttttactaattgtaaacactgccagtaaatgtggttttacacca
caatttgctggcctcgaaaaactttatgaaaaatataaagatcaaggattagaagtttta
ggttttccctgcaaccagtttggtgggcaagatccaggaagcaataaagaaattggtagc
ttctgtcagcgtaactatggggtaaaatttcccatgtttgctaaagttgatgtaaaaggt
ccggaagcccatgtgatttttagatatttaacacgtgaagctaaaggtattttaggtagt
agtagcattaaatggaactttaccaaatttttggtaggtaaagatggtgctgttttaaat
cgctatgcacctacgactaagccagaagctttagaagctgatattgaaaaagcattagcg
agttaa

DBGET integrated database retrieval system