KEGG   Acinetobacter calcoaceticus: BDGL_000970Help
Entry
BDGL_000970       CDS       T01684                                 

Gene name
glcB
Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
acc  Acinetobacter calcoaceticus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:acc01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:acc00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:acc00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1017177..1019342
Genome map
AA seq 721 aa AA seqDB search
MTARIQKGKLAIAKELYDFIENEALPGSGLDSETYWKNFEQVVVDLSPKNKALLAKRDEL
QAKIDEWHRNNKFELGAYKAFLTEIGYLLPEVEDFQITTENVDEEIALLAGPQLVVPVRN
ARYCLNAANARWGSLYDALYGFDVISEEGGAEKGKGYNPVRGAKVIEFAKNFLNEVFPLA
QGSHADATKYAIEQNKLVVTLKDGSKTGLAHEAQFVGFNGEEANPSEVVLLSNGLHVIIE
IDANSPIGQTDPAGVKDLTFEAAVTTIQDLEDSVAAVDAEEKVEGYRNWLGLMKGTLQES
IEKNGKTIVRDLNKDREIKNLIGGTTKLHGRSLMLLRNVGHLMTNPAILVDGEEIFEGIM
DALVTPLLSIADIRSTNENKNSRKGSMYIVKPKMHGPEEVAFAVELFERAEQAIGLPPKS
LKIGIMDEERRTSVNLKNCIAAAKDRTIFINTGFMDRTGDEIHTSMEAAPVVRKEAVKTQ
KWIAAYENRNVAIGLKCGLQGKAQIGKGMWPKPDSMKDMLATKAAHPNAGASCAWVPSPT
GAVLHAMHYHQVNVKARQDQLKAEEMLSLDDLLTPPFAPDTNWSAEEINNELENNCQGIL
GYVVRWVDLGVGCSKVPDINNVGLMEDRATLRISSQHVANWLRHGIVTREQVEEVLKRMA
KIVDEQNANDPLYKPMASNFETNIAFQAASDLIFKGCEQPSGYTEPLLHAARLKLKGYTG
D
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgactgcacgtattcaaaaaggcaagttagcgattgctaaagaactttacgattttatc
gaaaatgaagctttaccaggttctggtttagatagtgaaacttactggaagaactttgag
caagttgttgtcgatcttagcccaaaaaataaagcattattggctaagcgtgatgaatta
caagcaaaaattgatgagtggcaccgtaacaacaaatttgaattaggtgcttataaagcg
ttcttaactgaaattggttatttattaccagaagttgaagattttcaaatcactactgaa
aatgtagatgaagaaattgcgttgttggcaggaccacagttagttgtacctgtacgtaat
gcacgttattgcttaaatgcagcaaatgcccgttggggttctttatatgatgcactttac
ggcttcgatgtaatttctgaagaaggcggagctgaaaagggtaaaggatataatcctgtt
cgtggtgcaaaagttattgagttcgctaagaatttcttaaatgaagttttcccgcttgct
caaggttcacatgcagatgcaacaaaatatgcaattgagcaaaataaactcgttgtaact
ttgaaagatggttcaaaaacaggtttagctcatgaagctcagtttgttggtttcaatggt
gaggaagcaaatccttcagaagttgtacttttaagtaatggtcttcatgtcattatcgaa
attgatgcaaatagcccaattggacaaactgatccagcgggtgttaaagatttaacattt
gaagcggcagtaaccacaattcaagatttggaagactctgttgcggctgtcgatgcagaa
gaaaaagttgaaggttaccgtaactggttaggtttaatgaagggtacacttcaagaatct
attgaaaagaatggtaaaacgattgttcgtgatctaaataaagatcgcgaaattaaaaac
ttaattggtggtacaacaaaacttcatggtcgttcacttatgttacttcgtaacgtaggt
cacttaatgactaacccagctattttggtagacggcgaagaaatttttgaaggtattatg
gatgcattggtaactccattgttatcaattgctgatattcgtagtacaaacgaaaataaa
aactctcgtaaaggttctatgtatattgttaagccaaaaatgcatggtcctgaagaagtt
gcgtttgctgtagagttatttgaacgtgctgaacaggcgattggattaccacctaaatcg
ttaaaaatcggtattatggatgaagagcgccgtacgtctgtaaacttgaaaaactgtatt
gctgctgctaaagaccgtacaatctttattaatactggctttatggaccgtacgggtgac
gaaatccatacttctatggaagctgcgccagttgttcgtaaggaagctgttaaaacacaa
aaatggattgctgcttacgaaaaccgtaacgttgcaattggcttgaaatgtggtttacaa
ggtaaagcacagattggtaaaggcatgtggccaaagccagatagcatgaaggatatgtta
gcaactaaagctgcacatccaaatgctggtgcttcatgtgcttgggttccatctccaact
ggtgctgtacttcacgcgatgcattaccatcaagtgaatgtaaaagcacgtcaagatcag
ttaaaagctgaagaaatgttgtcattagatgacttgttaactcctccatttgcacctgat
acaaattggtcagcggaagagattaacaatgaacttgaaaataactgccaaggtatctta
ggttatgttgttcgttgggttgacttaggtgtaggttgttcgaaagttcctgatattaac
aacgtgggcttaatggaagaccgtgcaacattacgtatttcttctcaacacgttgctaac
tggttacgtcacggtattgtaactcgtgaacaagttgaagaagtgcttaaacgtatggca
aaaattgttgatgagcaaaatgcgaatgacccattgtataaaccaatggcatctaacttt
gaaacaaatattgctttccaagcagcttctgaccttatcttcaaaggttgtgaacagcct
tctggttacactgagccgttacttcatgctgctcgtttgaagttaaaaggttatacaggt
gattaa

DBGET integrated database retrieval system