KEGG   Acinetobacter calcoaceticus: BDGL_000970Help
Entry
BDGL_000970       CDS       T01684                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
acc  Acinetobacter calcoaceticus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:acc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BDGL_000970 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BDGL_000970 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    BDGL_000970 (glcB)
Enzymes [BR:acc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BDGL_000970 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1017177..1019342
Genome map
AA seq 721 aa AA seqDB search
MTARIQKGKLAIAKELYDFIENEALPGSGLDSETYWKNFEQVVVDLSPKNKALLAKRDEL
QAKIDEWHRNNKFELGAYKAFLTEIGYLLPEVEDFQITTENVDEEIALLAGPQLVVPVRN
ARYCLNAANARWGSLYDALYGFDVISEEGGAEKGKGYNPVRGAKVIEFAKNFLNEVFPLA
QGSHADATKYAIEQNKLVVTLKDGSKTGLAHEAQFVGFNGEEANPSEVVLLSNGLHVIIE
IDANSPIGQTDPAGVKDLTFEAAVTTIQDLEDSVAAVDAEEKVEGYRNWLGLMKGTLQES
IEKNGKTIVRDLNKDREIKNLIGGTTKLHGRSLMLLRNVGHLMTNPAILVDGEEIFEGIM
DALVTPLLSIADIRSTNENKNSRKGSMYIVKPKMHGPEEVAFAVELFERAEQAIGLPPKS
LKIGIMDEERRTSVNLKNCIAAAKDRTIFINTGFMDRTGDEIHTSMEAAPVVRKEAVKTQ
KWIAAYENRNVAIGLKCGLQGKAQIGKGMWPKPDSMKDMLATKAAHPNAGASCAWVPSPT
GAVLHAMHYHQVNVKARQDQLKAEEMLSLDDLLTPPFAPDTNWSAEEINNELENNCQGIL
GYVVRWVDLGVGCSKVPDINNVGLMEDRATLRISSQHVANWLRHGIVTREQVEEVLKRMA
KIVDEQNANDPLYKPMASNFETNIAFQAASDLIFKGCEQPSGYTEPLLHAARLKLKGYTG
D
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgactgcacgtattcaaaaaggcaagttagcgattgctaaagaactttacgattttatc
gaaaatgaagctttaccaggttctggtttagatagtgaaacttactggaagaactttgag
caagttgttgtcgatcttagcccaaaaaataaagcattattggctaagcgtgatgaatta
caagcaaaaattgatgagtggcaccgtaacaacaaatttgaattaggtgcttataaagcg
ttcttaactgaaattggttatttattaccagaagttgaagattttcaaatcactactgaa
aatgtagatgaagaaattgcgttgttggcaggaccacagttagttgtacctgtacgtaat
gcacgttattgcttaaatgcagcaaatgcccgttggggttctttatatgatgcactttac
ggcttcgatgtaatttctgaagaaggcggagctgaaaagggtaaaggatataatcctgtt
cgtggtgcaaaagttattgagttcgctaagaatttcttaaatgaagttttcccgcttgct
caaggttcacatgcagatgcaacaaaatatgcaattgagcaaaataaactcgttgtaact
ttgaaagatggttcaaaaacaggtttagctcatgaagctcagtttgttggtttcaatggt
gaggaagcaaatccttcagaagttgtacttttaagtaatggtcttcatgtcattatcgaa
attgatgcaaatagcccaattggacaaactgatccagcgggtgttaaagatttaacattt
gaagcggcagtaaccacaattcaagatttggaagactctgttgcggctgtcgatgcagaa
gaaaaagttgaaggttaccgtaactggttaggtttaatgaagggtacacttcaagaatct
attgaaaagaatggtaaaacgattgttcgtgatctaaataaagatcgcgaaattaaaaac
ttaattggtggtacaacaaaacttcatggtcgttcacttatgttacttcgtaacgtaggt
cacttaatgactaacccagctattttggtagacggcgaagaaatttttgaaggtattatg
gatgcattggtaactccattgttatcaattgctgatattcgtagtacaaacgaaaataaa
aactctcgtaaaggttctatgtatattgttaagccaaaaatgcatggtcctgaagaagtt
gcgtttgctgtagagttatttgaacgtgctgaacaggcgattggattaccacctaaatcg
ttaaaaatcggtattatggatgaagagcgccgtacgtctgtaaacttgaaaaactgtatt
gctgctgctaaagaccgtacaatctttattaatactggctttatggaccgtacgggtgac
gaaatccatacttctatggaagctgcgccagttgttcgtaaggaagctgttaaaacacaa
aaatggattgctgcttacgaaaaccgtaacgttgcaattggcttgaaatgtggtttacaa
ggtaaagcacagattggtaaaggcatgtggccaaagccagatagcatgaaggatatgtta
gcaactaaagctgcacatccaaatgctggtgcttcatgtgcttgggttccatctccaact
ggtgctgtacttcacgcgatgcattaccatcaagtgaatgtaaaagcacgtcaagatcag
ttaaaagctgaagaaatgttgtcattagatgacttgttaactcctccatttgcacctgat
acaaattggtcagcggaagagattaacaatgaacttgaaaataactgccaaggtatctta
ggttatgttgttcgttgggttgacttaggtgtaggttgttcgaaagttcctgatattaac
aacgtgggcttaatggaagaccgtgcaacattacgtatttcttctcaacacgttgctaac
tggttacgtcacggtattgtaactcgtgaacaagttgaagaagtgcttaaacgtatggca
aaaattgttgatgagcaaaatgcgaatgacccattgtataaaccaatggcatctaacttt
gaaacaaatattgctttccaagcagcttctgaccttatcttcaaaggttgtgaacagcct
tctggttacactgagccgttacttcatgctgctcgtttgaagttaaaaggttatacaggt
gattaa

DBGET integrated database retrieval system