KEGG   Acinetobacter calcoaceticus: BDGL_000986Help
Entry
BDGL_000986       CDS       T01684                                 

Gene name
cysQ
Definition
PapS (adenosine 3'-phosphate 5'-phosphosulfate) 3'(2'),5'-bisphosphate nucleotidase, converts PapS to APS
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
acc  Acinetobacter calcoaceticus
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:acc00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BDGL_000986 (cysQ)
Enzymes [BR:acc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     BDGL_000986 (cysQ)
Transfer RNA biogenesis [BR:acc03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    BDGL_000986 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1037065..1037922
Genome map
AA seq 285 aa AA seqDB search
MFITTTRPQDNLINQLLPILEQASQILLEEYQNYSAGYEFTIHEKQDDSPVTQADLKVNR
FLLKHLAEITPELPVLSEESDYSARHDWSTCWMLDPLDGTKEFIHERDEFTINLSMINGK
ETVFSVIAVPCEQVVYLGYLQDLPFKYSFSQQQWYQYQVSSTSLDVPIQIGLSHGSKNPK
YQKFIQPIEKEHRIIRREAGSAYKFCMMLEGEIDIYPRFHPTSEWDTSSGQGLLESIGGG
LLTLDGKPFEYNQRNTVLNKGFIAFRDQESKKIAFEALAQSGVID
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtttataacaactacacgcccacaagataatttaattaatcaacttctgccgattctg
gaacaggcgagtcagattttactagaagaatatcaaaactattctgcgggttatgagttt
actattcatgaaaagcaagatgactcacctgtaacccaagcagatctaaaggtaaataga
tttttactaaaacatcttgcagagattactccagagttgcccgtattatcagaagaaagt
gattatagtgcccgtcatgactggtctacttgctggatgttagatccgcttgatggaacc
aaagaatttatacatgaacgtgatgaatttacgatcaatctaagcatgatcaacggcaaa
gaaacggttttctcagttattgccgtgccatgtgaacaagttgtgtacttaggatatctg
caagatttaccttttaaatatagctttagccaacaacaatggtatcaatatcaggttagt
tcaacttcgctagatgtgcccatacaaataggacttagtcacggtagtaaaaatccaaaa
taccaaaaatttattcaacctatagaaaaagaacatcgcattattcgacgagaagctgga
agtgcctataagttttgtatgatgttagaaggtgaaatagatatttacccacgctttcat
cctacttctgaatgggatacaagttctggtcaaggtctgttagaaagtataggcggtggt
ttacttactctggatggaaaaccttttgaatataaccaaagaaatacagttttaaataag
ggctttatcgcttttcgtgatcaggaaagcaaaaaaatagcatttgaagcattagctcaa
tcaggtgttatagattga

DBGET integrated database retrieval system