KEGG   Acinetobacter calcoaceticus: BDGL_001042Help
Entry
BDGL_001042       CDS       T01684                                 

Gene name
recR
Definition
recombination protein, gap repair
Orthology
K06187  
recombination protein RecR
Organism
acc  Acinetobacter calcoaceticus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:acc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BDGL_001042 (recR)
DNA repair and recombination proteins [BR:acc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BDGL_001042 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1093285..1093881
Genome map
AA seq 198 aa AA seqDB search
MFSDRFEQLVQALRILPSVGPKSAQRMALHLLMKNREGAFALAHALHEASSYIHECSVCH
SLTEHEICDICASTDRDDQLLCVVESPADVMAIEQSGSFRGKYHVLGGHLSPLDGIGPEE
IGIPYLIQRLSQGTIEEVILATNATVEGQATAHYLVEATKHLPIQMTRIAQGVPQGGELE
YVDSHTLSQAVHNRMRMK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgtttagcgatagatttgaacaactcgttcaagctttacgtatattgccaagcgttggt
ccgaagtcggctcaacgtatggctttacatcttttgatgaaaaaccgagaaggggcattt
gcattagcgcatgctttacatgaggcttcaagttatatacatgaatgtagtgtctgccat
tctctgactgaacatgaaatttgtgatatttgcgcctcaactgacagagatgatcagtta
ttgtgtgtggttgaatcaccagcggatgtgatggcgattgagcaaagcggtagctttcgt
ggaaaataccatgttttaggtggccatctttctccattagatggtattggtccggaagaa
attggtattccttatctcattcagcgtctaagccaaggtactattgaagaagtcattttg
gcaaccaatgcgacggtagaaggacaagcgacagcccattatttggtagaggcgactaaa
catttaccaatacaaatgacgcgtattgctcaaggtgtacctcagggtggtgaactcgaa
tacgtagatagccatactttaagtcaggcagtgcataaccgcatgagaatgaaataa

DBGET integrated database retrieval system