KEGG   Acinetobacter calcoaceticus: BDGL_001053Help
Entry
BDGL_001053       CDS       T01684                                 

Gene name
trpB2
Definition
tryptophan synthase beta chain
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
acc  Acinetobacter calcoaceticus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:acc01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:acc00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:acc00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1101832..1103037
Genome map
AA seq 401 aa AA seqDB search
MQHQINGIALPNEQGFFGEYGGQFIPPHLKEAMDKINVAYEEIRHTPEFQNELSDLFSNY
VGRPSPLFHAKRLSEQLGGAQIYLKREDLNHTGAHKINHCLGEALLAKYMGKKKVIAETG
AGQHGVALATACALVGIPCEIHMGQVDIEKEHPNVVKMKILGAHLVSVTRGTATLKDAVD
SAFEEYLKDPKNFIYAIGSVVGPHPFPKMVRDFQSIIGNEIKEQTHHRFGKNPDYVVACV
GGGSNAIGAFTAFLNDSDVKLVGVEPAGHGLETHMHSATLTLGKPSQIHGMACYVLENEA
GEPLPVHSIASGLDYPGVGPQHSFLKDLGRVEYSTATDQECLDAFMTLSRVEGIVPALES
SHAVAWAIREAPKLSKETMIVVNLSGRGDKDSDYVAEKLKL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcaacatcaaattaatggtattgctttaccaaatgaacagggattttttggtgaatat
ggaggccaatttattcctccgcatttaaaagaagcaatggataaaattaatgttgcttat
gaagaaattcgccatacaccagaatttcaaaatgaattatcagacctcttttcaaattat
gtaggtcgtccaagtcctttatttcacgcaaaacgtctttctgagcagttaggcggtgca
caaatttatttaaaacgtgaagacttaaatcatacaggtgcccataaaattaatcactgt
ttaggtgaggctctacttgctaaatatatgggtaaaaagaaagtcattgctgagactggt
gcaggacagcatggtgttgctttagccacggcttgtgctttagttggtattccatgtgaa
attcatatgggacaagtcgatattgaaaaagaacaccctaatgtggtcaaaatgaaaatt
ttgggtgctcatttagtttcagtaacacgtggtacagcaaccttaaaagatgctgtagat
agcgcgtttgaggaatatttaaaagaccctaaaaattttatttatgcgattggttctgtg
gttggaccacatccatttccaaaaatggtccgagattttcaatcgattattggtaatgaa
attaaagagcaaacgcatcatcgttttggtaaaaacccagattatgttgtcgcatgtgtt
ggtggcggttcaaatgcaatcggtgcctttacagcatttttaaatgattcggatgtgaaa
ttggttggggttgaaccagcaggacatggtttagaaactcacatgcattcggcaacttta
accttagggaaaccaagtcaaattcatggtatggcgtgttacgtgcttgaaaatgaagct
ggtgaaccgttacccgtgcattctattgcttcaggattggactatcctggtgttgggcca
cagcatagtttcttaaaagatttaggccgtgtggaatatagcactgcaactgaccaagaa
tgtttggatgcttttatgaccttatctcgtgtagagggaattgttcctgcgcttgaaagc
tcacacgctgtcgcatgggcaatacgagaagcaccaaagctgtcgaaagaaaccatgatt
gtggttaatctttctggtcgtggagacaaagattcggattatgtggcagaaaaacttaag
ctttaa

DBGET integrated database retrieval system