KEGG   Acinetobacter pittii: BDGL_001053Help
Entry
BDGL_001053       CDS       T01684                                 

Gene name
trpB2
Definition
(RefSeq) tryptophan synthase beta chain
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
acc  Acinetobacter pittii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:acc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BDGL_001053 (trpB2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BDGL_001053 (trpB2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BDGL_001053 (trpB2)
Enzymes [BR:acc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BDGL_001053 (trpB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1101832..1103037
Genome map
AA seq 401 aa AA seqDB search
MQHQINGIALPNEQGFFGEYGGQFIPPHLKEAMDKINVAYEEIRHTPEFQNELSDLFSNY
VGRPSPLFHAKRLSEQLGGAQIYLKREDLNHTGAHKINHCLGEALLAKYMGKKKVIAETG
AGQHGVALATACALVGIPCEIHMGQVDIEKEHPNVVKMKILGAHLVSVTRGTATLKDAVD
SAFEEYLKDPKNFIYAIGSVVGPHPFPKMVRDFQSIIGNEIKEQTHHRFGKNPDYVVACV
GGGSNAIGAFTAFLNDSDVKLVGVEPAGHGLETHMHSATLTLGKPSQIHGMACYVLENEA
GEPLPVHSIASGLDYPGVGPQHSFLKDLGRVEYSTATDQECLDAFMTLSRVEGIVPALES
SHAVAWAIREAPKLSKETMIVVNLSGRGDKDSDYVAEKLKL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcaacatcaaattaatggtattgctttaccaaatgaacagggattttttggtgaatat
ggaggccaatttattcctccgcatttaaaagaagcaatggataaaattaatgttgcttat
gaagaaattcgccatacaccagaatttcaaaatgaattatcagacctcttttcaaattat
gtaggtcgtccaagtcctttatttcacgcaaaacgtctttctgagcagttaggcggtgca
caaatttatttaaaacgtgaagacttaaatcatacaggtgcccataaaattaatcactgt
ttaggtgaggctctacttgctaaatatatgggtaaaaagaaagtcattgctgagactggt
gcaggacagcatggtgttgctttagccacggcttgtgctttagttggtattccatgtgaa
attcatatgggacaagtcgatattgaaaaagaacaccctaatgtggtcaaaatgaaaatt
ttgggtgctcatttagtttcagtaacacgtggtacagcaaccttaaaagatgctgtagat
agcgcgtttgaggaatatttaaaagaccctaaaaattttatttatgcgattggttctgtg
gttggaccacatccatttccaaaaatggtccgagattttcaatcgattattggtaatgaa
attaaagagcaaacgcatcatcgttttggtaaaaacccagattatgttgtcgcatgtgtt
ggtggcggttcaaatgcaatcggtgcctttacagcatttttaaatgattcggatgtgaaa
ttggttggggttgaaccagcaggacatggtttagaaactcacatgcattcggcaacttta
accttagggaaaccaagtcaaattcatggtatggcgtgttacgtgcttgaaaatgaagct
ggtgaaccgttacccgtgcattctattgcttcaggattggactatcctggtgttgggcca
cagcatagtttcttaaaagatttaggccgtgtggaatatagcactgcaactgaccaagaa
tgtttggatgcttttatgaccttatctcgtgtagagggaattgttcctgcgcttgaaagc
tcacacgctgtcgcatgggcaatacgagaagcaccaaagctgtcgaaagaaaccatgatt
gtggttaatctttctggtcgtggagacaaagattcggattatgtggcagaaaaacttaag
ctttaa

DBGET integrated database retrieval system