KEGG   Acinetobacter calcoaceticus: BDGL_001106Help
Entry
BDGL_001106       CDS       T01684                                 

Gene name
bdhA
Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
acc  Acinetobacter calcoaceticus
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acc00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BDGL_001106 (bdhA)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BDGL_001106 (bdhA)
Enzymes [BR:acc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BDGL_001106 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1156398..1157183
Genome map
AA seq 261 aa AA seqDB search
MTKLLDGKVAFITGSASGIGLEIAKKFAQEGAKIVISDMNAEKCQETANSLKEQGFDALS
APCDVTDEDAYKQAIELTQKTFGTVDILINNAGFQHVSSIEEFPTAVFQKLVQVMLTGAF
IGIKHVLPIMKAQKYGRIINMASINGLIGFAGKAGYNSAKHGVIGLTKVAALECARDGIT
VNALCPGYVDTPLVRGQIADLAKTRNVSLDSALEDVILAMVPQKRLLSVEEIADYAIFLA
SSKAGGVTGQAVVMDGGYTAQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacttttagacggtaaggtcgcttttattacaggttctgcaagtggtatcggt
ctagagattgctaagaaatttgctcaagaaggtgccaaaattgttatttctgatatgaat
gctgaaaagtgtcaagaaacggcgaactcacttaaagaacaaggttttgatgcattatct
gcaccatgtgatgtgactgatgaagatgcttataaacaagccattgagcttactcaaaag
acttttggtacggttgatatcttaattaataatgctggtttccaacacgtttcatctatt
gaagagtttccaactgctgtttttcaaaagttagttcaagtcatgttaacgggggcattt
attgggattaaacatgttcttccaattatgaaagctcaaaaatatggccgtatcattaat
atggcttcaattaatggtttgattggtttcgctggaaaggctggttataacagcgcgaaa
cacggcgtgattggcctaacgaaagttgcggcattggaatgtgcacgtgacggtattacg
gtaaatgctttatgcccaggttatgtagatacgccattggttcgtgggcaaattgcagac
ttggctaaaacccgtaatgtaagtttagacagcgcacttgaagatgttatcttggcaatg
gttcctcaaaagcgtttattgtctgttgaagaaattgctgactatgcgattttccttgcg
agtagcaaagcaggtggggtaaccggccaagctgttgttatggatggtggttacaccgct
caataa

DBGET integrated database retrieval system