KEGG   Acinetobacter calcoaceticus: BDGL_001400Help
Entry
BDGL_001400       CDS       T01684                                 

Gene name
pldA
Definition
putative phospholipase A1 precursor
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
acc  Acinetobacter calcoaceticus
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:acc00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:acc00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:acc00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:acc00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:acc00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1502675..1503826)
Genome map
AA seq 383 aa AA seqDB search
MAFKQFERTSLQLSMGIVLSFLCASVTYADTLAPANPATVDACVALASNADRLACYDSVF
KPAALPVVQAAVIPEPVKKIDQPAVQPETFKEKVVDTVSNIKVIGKAPTLEPTTSLLDQR
WELSEKSKLGVWNIRAYQPVYLLPVFWTSDKNEFPSSPNPNNTVTDAQNLKSTESKFQIS
LKTKAWENIFGNNGDLWVGYTQSSRWQTFNAEESRPFRETNYEPEASLMFRTNYELLGLD
GRLLGVTLNHQSNGRSDPLSRSWNRVIFNVGLERGNFALMLRPWIRLEEDSKDDNNPDME
DYIGRGDLTAFYKWKQNDFSLMLRHSLKGGDDSHGAVQFDWAFPISGKLRGHFQLFNGYG
ESLIDYNHRATYAGLGVSLLNWY
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcaaacaatttgaacgcacatctttacagctaagcatgggaatcgtgcttagc
tttttatgtgcgtctgtaacatatgctgataccttagctccagcaaaccctgccacagtt
gatgcatgtgttgctcttgcttcgaatgccgatcgtctagcttgttacgactctgtattt
aagccagcagctctacctgttgtacaagccgcggtaatacctgagcctgttaaaaaaatc
gatcagcccgctgttcaaccggaaacatttaaagagaaggttgtagatacagttagtaat
attaaagtgattggtaaagcgcctacacttgaacctactacttctttgctagatcaacgt
tgggagttatctgaaaaaagtaagctaggtgtttggaatattcgtgcttatcagcccgtc
tatttattacccgtattttggaccagtgacaagaatgaattcccgagtagcccaaatcca
aataacactgtaacggatgctcagaatctgaaatcaacagaaagtaagtttcagatttct
ttgaaaaccaaagcttgggaaaatatttttggaaataacggtgatttgtgggtagggtat
acacaatcttcacgttggcagacgttcaatgctgaagaatctcgcccattccgtgaaacg
aactatgagccagaagcaagtttaatgtttagaacgaactacgagttgcttggtttagat
gggcgtttgctcggggttaccttaaaccatcagtcaaatggtcgctcagatccattatct
cgtagctggaaccgcgtcatctttaatgttggattggagcgtggtaattttgctttaatg
ctccgtccatggattcgtcttgaagaagatagtaaagatgataataatccggatatggaa
gattacatcggccgtggtgatttaacagcgttttataagtggaagcagaatgatttctct
ttaatgctgcgtcattcattgaaaggtggtgatgactctcatggtgctgtgcaatttgac
tgggcttttccaatcagtggcaaattacgcggacatttccagttgtttaatggttatggt
gaaagcctaattgattataaccatcgagcaacttatgctggtttgggtgtatcgctcttg
aattggtactaa

DBGET integrated database retrieval system