KEGG   Acinetobacter calcoaceticus: BDGL_001853Help
Entry
BDGL_001853       CDS       T01684                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
acc  Acinetobacter calcoaceticus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:acc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BDGL_001853 (folE)
Enzymes [BR:acc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BDGL_001853 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1994962..1995510
Genome map
AA seq 182 aa AA seqDB search
MQQSYANILTAVGEDLDRPGLKDTPVRAAKAFSYLTSGYSKTLEEVTNNAVFPSDNHEMV
LVKNIEFYSLCEHHLLPFYGRVHVAYLPEGKVLGLSKFARITEMFARRLQIQENLTQQIA
EAVAEVTGARGVAVVIDSAHMCMMMRGVGKQESTTRTVSFVGDFKTDKEARREFLSAVPE
SY
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaatcgtacgcaaatatcctgactgccgtcggtgaagatcttgatcgtcccggc
cttaaagatacgcctgtgcgtgcggctaaagctttttcatatttaacttctggctatagt
aaaactttagaagaagtcaccaataatgctgttttcccatcagataaccatgaaatggta
ttggtgaagaatattgaattctattcgctttgcgaacatcatctcctcccattctacggt
cgtgttcatgttgcctatttaccggaaggcaaagttcttggcttatctaaatttgcacga
attaccgagatgtttgctcgccgtttgcaaattcaggaaaatctgactcaacaaatcgca
gaagctgtcgcagaagtgactggtgctcgcggtgttgctgtagtcatcgattcagcacat
atgtgtatgatgatgcgtggtgtaggtaaacaagagtctacaacccgtacagtttcattt
gtcggcgattttaaaaccgacaaagaagcacgtcgtgaatttttaagtgcagtaccagaa
agctattaa

DBGET integrated database retrieval system