KEGG   Acinetobacter pittii: BDGL_002146Help
Entry
BDGL_002146       CDS       T01684                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
acc  Acinetobacter pittii
Pathway
acc00020  Citrate cycle (TCA cycle)
acc00640  Propanoate metabolism
acc00660  C5-Branched dibasic acid metabolism
acc01100  Metabolic pathways
acc01110  Biosynthesis of secondary metabolites
acc01120  Microbial metabolism in diverse environments
acc01130  Biosynthesis of antibiotics
acc01200  Carbon metabolism
Module
acc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
acc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:acc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BDGL_002146 (sucC)
   00640 Propanoate metabolism
    BDGL_002146 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BDGL_002146 (sucC)
Enzymes [BR:acc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BDGL_002146 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-GeneID: 11636669
NCBI-ProteinID: YP_004996414
UniProt: F0KLX8
Position
complement(2332255..2333421)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKALLKEYGMPVQEGILATNADEAVAAFEQLGGKFAVMKAQVHAGGRGKAGGV
KVAKSKEDVIEFANNIIGTRLVTYQTDANGQPVNSIIVAEDVYPVERELYLGAVVDRSSR
RITFMASTEGGVEIEKVAEETPEKIIKVEVDPLVGLQPFQAREVAFALGLKDKQIGQFVK
IMTAAYQAFVENDFALFEINPLSVRENGEILCVDAKVGIDSNALYRLPKVAALRDKSQEN
ERELKASEFDLNYVALEGNIGCMVNGAGLAMATMDIIKLYGGQPANFLDVGGGATKERVI
EAFKIILADTSVQGVLINIFGGIVRCDMIAEAIIAAVQEVNVTVPVVVRLEGNNAELGAK
LLDESGLKLISANGLSDAAEKVVAAVKA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgagtatcaagctaaagcgttattgaaagaatatggtatgccagtacaa
gaaggtatcttggctaccaatgcagacgaagcagttgctgcatttgaacagcttggtggt
aaattcgcggtaatgaaagcgcaagttcatgctggtggtcgtggtaaggctggtggcgtt
aaagttgcaaaatctaaagaagacgttatcgaatttgcaaacaatatcattggtactcgt
cttgtaacgtatcaaacagatgcaaatggtcaaccagtaaacagcattattgttgctgaa
gacgtatacccagttgagcgtgagctttacttaggtgcggttgtagaccgttctagccgt
cgtattactttcatggcttctacagaaggtggtgtagaaatcgagaaagttgctgaagaa
actccagaaaaaattatcaaagttgaagttgatccattagttggcttacaaccattccaa
gcacgtgaagttgcgtttgctttaggtttgaaagacaagcaaattggtcaatttgtaaaa
atcatgacagctgcttaccaagcatttgttgaaaatgactttgcattatttgaaattaac
ccactttcagttcgtgaaaatggcgaaattttatgtgttgatgcgaaagtaggtatcgac
tctaacgcgctttaccgtttacctaaagttgctgctttacgtgacaaatctcaagagaat
gagcgtgaattaaaagcatctgaatttgatcttaactatgttgctttagaaggtaacatt
ggttgtatggttaacggtgctggtcttgcaatggcaactatggacatcattaaactttat
ggtggtcagcctgcaaacttccttgacgttggtggcggtgcaactaaagagcgcgtaatc
gaagcgttcaaaatcatccttgctgatacatctgtacaaggtgttttaatcaacatcttc
ggtggtatcgtacgttgtgacatgattgctgaagcgattattgcagcggttcaagaagta
aacgtaactgttccagttgttgttcgtttagaaggtaacaacgctgagttaggtgctaaa
ttacttgatgaatctggtttgaaattaatttctgcaaacggcttgtctgatgccgcagaa
aaagttgtagctgcagttaaagcgtaa

DBGET integrated database retrieval system