KEGG   Acinetobacter pittii: BDGL_002148Help
Entry
BDGL_002148       CDS       T01684                                 

Gene name
sucB
Definition
(RefSeq) dihydrolipoamide succinyltransferase, component of 2-oxoglutarate dehydrogenase complex (E2)
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
acc  Acinetobacter pittii
Pathway
acc00020  Citrate cycle (TCA cycle)
acc00310  Lysine degradation
acc01100  Metabolic pathways
acc01110  Biosynthesis of secondary metabolites
acc01120  Microbial metabolism in diverse environments
acc01130  Biosynthesis of antibiotics
acc01200  Carbon metabolism
Module
acc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
acc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:acc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BDGL_002148 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    BDGL_002148 (sucB)
Enzymes [BR:acc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BDGL_002148 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-GeneID: 11636671
NCBI-ProteinID: YP_004996416
UniProt: F0KLY0
Position
complement(2335064..2336260)
Genome map
AA seq 398 aa AA seqDB search
MATEIKAPVFPESVADGTIATWHKKVGEPVSRDEVICDIETDKVVLEVVAPADGSLVAII
KDEGDTVLSDEVIAQFEAGAGAAAAAPAAVEQAVAQTQAGAAPVVERTETVSDQAPAVRK
ALTESGIAAADVQGTGRGGRITKEDVANHQAKPAANVTPLSVAVGERIEKRVPMTRLRKR
VAERLLAATQETAMLTTFNEVNMKPIMELRKQYKDAFEKRHGARLGFMSFFVKAATEALK
RYPAVNASIDGDDIVYHGYYDIGVAVSSDRGLVVPVLRDTDRMSYAEVESGIGAYAAKAR
DGKLSIEEMTGGTFTITNGGTFGSLLSTPILNQPQTGILGMHKIQERPMAVNGQVEILPM
MYLALSYDHRMIDGKEAVGFLVAIKELLEEPAKLILDL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgaaattaaagcaccggtattcccagagtctgttgcagatggaaccatcgca
acttggcacaaaaaggtgggtgaacctgtatcacgtgatgaagtaatctgtgatattgaa
accgacaaagttgttttagaagttgttgctcctgctgatggtagcttagttgcaatcatt
aaagatgaaggcgatacagttctttctgacgaagttattgctcaatttgaagctggtgct
ggtgcggcagcggctgctcctgcagcagtagagcaagcagttgctcaaactcaagctggt
gcagcgcctgttgttgagcgtacagaaactgtatctgatcaagctcctgcagttcgtaaa
gcattaactgaatctggtattgctgctgctgacgtacaaggtactggtcgtggtggtcgt
atcactaaagaagatgttgcaaaccatcaagctaaaccagctgctaacgttactccgtta
agtgtggctgttggtgagcgtatcgaaaaacgcgttccaatgactcgtttacgtaagcgt
gtagctgagcgtcttcttgctgcaactcaagaaactgcaatgttaactacattcaacgaa
gttaacatgaagccaatcatggaattgcgtaagcaatataaagatgcttttgaaaaacgt
catggcgctcgtttaggcttcatgtcattcttcgttaaagcagcaactgaagcgcttaaa
cgctacccagctgtaaacgcttcaattgatggcgacgatatcgtttatcacggttactat
gacatcggtgttgcagtatcttctgatcgtggtcttgttgtaccagtattacgtgatact
gatcgtatgagctatgcagaagttgaatctggtattggtgcatatgctgctaaagcacgt
gatggtaaattatctatcgaagaaatgactggtggtactttcacaatcactaacggtggt
actttcggttcgttactttcaactccaattttgaatcagccacaaactggtattttgggt
atgcataaaatccaagagcgtcctatggctgtaaatggtcaagttgaaatcttgccaatg
atgtatttagcactttcttatgaccaccgtatgatcgatggtaaagaagctgtaggtttc
ttggtagcaatcaaagaattgttagaagagccagctaaactcatccttgatctttaa

DBGET integrated database retrieval system