KEGG   Acinetobacter pittii: BDGL_002154Help
Entry
BDGL_002154       CDS       T01684                                 

Gene name
sdhD
Definition
(RefSeq) succinate dehydrogenase, hydrophobic subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
acc  Acinetobacter pittii
Pathway
acc00020  Citrate cycle (TCA cycle)
acc00190  Oxidative phosphorylation
acc00650  Butanoate metabolism
acc01100  Metabolic pathways
acc01110  Biosynthesis of secondary metabolites
acc01120  Microbial metabolism in diverse environments
acc01130  Biosynthesis of antibiotics
acc01200  Carbon metabolism
Module
acc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
acc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
acc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:acc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BDGL_002154 (sdhD)
   00650 Butanoate metabolism
    BDGL_002154 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    BDGL_002154 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-GeneID: 11636677
NCBI-ProteinID: YP_004996422
UniProt: F0KME5
Position
complement(2342243..2342608)
Genome map
AA seq 121 aa AA seqDB search
MKSATGLTGSGSRDWFIQRVSAVVLAAYTVVLFGWILCKGGFDYQQWAGFMMTLPMKIFS
LLAILSLIAHAWIGMWQVFTDYVTTRQMGPSAKGLRLVLTTAVIIAVFVYAIWGIQIFWA
N
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtgctacaggtttaactggttcaggttctcgtgattggtttatccagcgtgta
agtgcggttgtattagcagcttatactgttgttctttttggttggattctctgcaaaggt
ggatttgactatcaacagtgggctggcttcatgatgacattaccaatgaagattttttct
ttattggcaattttatcgcttatcgcacacgcatggattggtatgtggcaagttttcact
gactatgtcactactcgtcaaatgggtccttcagcgaaaggtttacgccttgtactgacg
acggctgtcattattgcagtgtttgtgtacgcaatctggggtatccagattttctgggcg
aattga

DBGET integrated database retrieval system