KEGG   Acinetobacter calcoaceticus: BDGL_002154Help
Entry
BDGL_002154       CDS       T01684                                 

Gene name
sdhD
Definition
succinate dehydrogenase, hydrophobic subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
acc  Acinetobacter calcoaceticus
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:acc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BDGL_002154 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BDGL_002154 (sdhD)
   00650 Butanoate metabolism
    BDGL_002154 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    BDGL_002154 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2342243..2342608)
Genome map
AA seq 121 aa AA seqDB search
MKSATGLTGSGSRDWFIQRVSAVVLAAYTVVLFGWILCKGGFDYQQWAGFMMTLPMKIFS
LLAILSLIAHAWIGMWQVFTDYVTTRQMGPSAKGLRLVLTTAVIIAVFVYAIWGIQIFWA
N
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtgctacaggtttaactggttcaggttctcgtgattggtttatccagcgtgta
agtgcggttgtattagcagcttatactgttgttctttttggttggattctctgcaaaggt
ggatttgactatcaacagtgggctggcttcatgatgacattaccaatgaagattttttct
ttattggcaattttatcgcttatcgcacacgcatggattggtatgtggcaagttttcact
gactatgtcactactcgtcaaatgggtccttcagcgaaaggtttacgccttgtactgacg
acggctgtcattattgcagtgtttgtgtacgcaatctggggtatccagattttctgggcg
aattga

DBGET integrated database retrieval system