KEGG   Acinetobacter pittii: BDGL_002313Help
Entry
BDGL_002313       CDS       T01684                                 

Gene name
fadA
Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
acc  Acinetobacter pittii
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:acc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BDGL_002313 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    BDGL_002313 (fadA)
   00640 Propanoate metabolism
    BDGL_002313 (fadA)
   00650 Butanoate metabolism
    BDGL_002313 (fadA)
  Lipid metabolism
   00071 Fatty acid degradation
    BDGL_002313 (fadA)
   00072 Synthesis and degradation of ketone bodies
    BDGL_002313 (fadA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BDGL_002313 (fadA)
   00310 Lysine degradation
    BDGL_002313 (fadA)
   00380 Tryptophan metabolism
    BDGL_002313 (fadA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BDGL_002313 (fadA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BDGL_002313 (fadA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BDGL_002313 (fadA)
Enzymes [BR:acc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BDGL_002313 (fadA)
Exosome [BR:acc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BDGL_002313 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2508958..2510226
Genome map
AA seq 422 aa AA seqDB search
MPFKTSTLKTQQSLSNKKGTVMSEAYIIDAIRTPRGKGKKDGSLYEVKPITLLTTLLNEL
QQRHQLDTSKVDDIVLGCVTPIGDQGGDIAKTAAIAAGWNDDVAGVQINRFCASGLEAVN
MAAMKVRSGWEDLVVAGGVESMSRIPMGSDGGPWALDPETNLKSSFVPQGIGADLIATLD
GYSREDVDNFAVKSQQKAAAAQSNGYFDQSVVPVKDHAGVVILEKDEFIKGNTTLEGLTK
LNPSFEMMGQMGFDAVALQKYPEAQKINHVHHAGNSSGIVDGAAVVLLASEKAVKEQNLK
PRAKVLATALVGTDPTIMLTGPAPAARKALEKAGLTIDDIDLFEVNEAFAAVVMRFINEL
NVPAEKVNVNGGAIALGHPLGATGAMILGTLLDELERQDKKRGLATLCVGGGMGIATIIE
RV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
ttgccttttaaaaccagtacactcaaaacacaacaaagtttaagtaataaaaaaggaact
gttatgagcgaggcttatattattgatgccattcgcaccccacgcggaaaaggaaaaaaa
gatggctctctttacgaagtaaaaccaattacattactgacgaccttattaaatgaatta
cagcagcgccatcaactcgatacctctaaagttgacgatattgttttgggctgcgtaaca
ccaattggcgatcaaggtggtgatattgccaaaacagcagcgattgcagcaggttggaat
gatgatgttgctggggtgcaaatcaatcgcttttgtgcatcaggcttagaagcagtcaat
atggcagcaatgaaagtccgctctggttgggaagatttagtggttgctggtggcgttgaa
tcaatgtcacgcattccaatgggctcggatggtgggccgtgggcattagatccagaaaca
aatcttaagtcatcatttgttccacaaggtattggggccgacctcattgcaaccttagat
ggctatagccgtgaagatgttgataattttgctgtaaagtcacagcaaaaagcggcggcg
gctcaatcaaatggttatttcgaccaatcagttgtgccggtaaaagatcacgcaggtgtg
gtgattttagagaaagatgaatttattaaaggtaataccacactcgaaggtctaacgaag
ctcaacccaagttttgaaatgatgggccaaatgggctttgatgcagttgctttacaaaaa
tatccggaagcacaaaaaatcaatcatgttcatcacgcaggtaactcatcaggcattgtc
gatggagcagctgtagttttattagcttctgaaaaagcggtaaaagaacaaaacttaaaa
ccacgcgctaaagttttagcgactgcactggttggtaccgacccaaccatcatgctgact
ggccctgctcctgctgcacgtaaagctttagaaaaagctggtcttactattgatgatatt
gacctctttgaagtcaatgaagcctttgcagctgttgtaatgcgttttattaatgagctc
aacgtccctgctgaaaaagtcaacgtaaacggcggtgcgattgctttaggccatccgtta
ggagcaacaggtgccatgattttaggcacattacttgatgagcttgaacgacaagataaa
aagcgcggtttagcgacgctctgtgttggcggtgggatgggtattgccaccattattgaa
cgcgtataa

DBGET integrated database retrieval system