KEGG   Acinetobacter pittii: BDGL_002315Help
Entry
BDGL_002315       CDS       T01684                                 

Gene name
fadJ
Definition
(RefSeq) putative 3-hydroxybutyryl-CoA epimerase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
acc  Acinetobacter pittii
Pathway
acc00071  Fatty acid degradation
acc00280  Valine, leucine and isoleucine degradation
acc00281  Geraniol degradation
acc00310  Lysine degradation
acc00362  Benzoate degradation
acc00380  Tryptophan metabolism
acc00410  beta-Alanine metabolism
acc00640  Propanoate metabolism
acc00650  Butanoate metabolism
acc00903  Limonene and pinene degradation
acc00930  Caprolactam degradation
acc01040  Biosynthesis of unsaturated fatty acids
acc01100  Metabolic pathways
acc01110  Biosynthesis of secondary metabolites
acc01120  Microbial metabolism in diverse environments
acc01130  Biosynthesis of antibiotics
acc01200  Carbon metabolism
acc01212  Fatty acid metabolism
Module
acc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:acc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BDGL_002315 (fadJ)
   00650 Butanoate metabolism
    BDGL_002315 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    BDGL_002315 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    BDGL_002315 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BDGL_002315 (fadJ)
   00310 Lysine degradation
    BDGL_002315 (fadJ)
   00380 Tryptophan metabolism
    BDGL_002315 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BDGL_002315 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BDGL_002315 (fadJ)
   00281 Geraniol degradation
    BDGL_002315 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BDGL_002315 (fadJ)
   00930 Caprolactam degradation
    BDGL_002315 (fadJ)
Enzymes [BR:acc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BDGL_002315 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BDGL_002315 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BDGL_002315 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 NAD_binding_2 AlaDh_PNT_C F420_oxidored DUF5333 Methyltransf_31
Motif
Other DBs
NCBI-GeneID: 11636846
NCBI-ProteinID: YP_004996583
UniProt: F0KNS6
Position
2510490..2512376
Genome map
AA seq 628 aa AA seqDB search
MVEKLKGHLRTIETLGIPVVAALNGTALGGGWEIALSCHHRIAINDPKSKFGLPEVTLGL
LPGGGGIVRMVRLLGLQNAFPFLMEGKQFGVDKAKSLGLIHDTAENEQELLDKAIAWIKA
NPKSQQPFDVKGYKIPGGDPKTPAVAQVLAIAPAMLRDKTKGCYPAPEAIMAAAVEGAQV
DVDTALRIESRYFTQLTTGQISKNMIGTFWHGLNAIKSGASRPADVAKWQATKVGVLGAG
MMGAGIAYSTAIKGIPVVLKDVSVENAEKGKAYSQKLLDKRVSQGRMTAEKRDQVLSLIT
ATASAEDLQGCDLIIEAVFENQELKAKVTQEAEQYLAPNGVMASNTSTLPITGLAQASKD
DKAFIGLHFFSPVDKMQLVEIIKGKNTSAETLAKAYDFVQQIGKTPIVVNDSRGFFTSRV
FGTFIQEGMRLLAEGVHPARIEMAALKAGMPVGPLAIQDEVSLTLTEHVASEARKALQAE
GKDLPKTSVDEVVHTMIHELNRKGKAAGAGFYEYPENGKKHLWEGLNRWKKDHDISEQDM
IDRILFVQALDTLRCYEEGVLESVIDANVGSIFGIGYAPWTGGAIQFLNQYGTDKAQKRA
EELAAKYGERFTPPALLKTKAEQKQNIQ
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggttgaaaagctaaaaggtcatttacgtacaattgaaacgcttggtattccagtcgtt
gcagcattaaatggtactgcacttggcggtggttgggaaattgcattaagttgccatcac
cgtattgcaatcaatgacccgaaaagcaaatttggcttaccagaagttactttaggtttg
ttaccaggcggcggtggtattgtacgtatggtacgtttgcttgggcttcaaaatgcattt
cctttcttaatggaaggcaaacagttcggtgttgataaagcaaaatctttaggtttaatt
catgacactgccgaaaatgagcaagaacttttagataaagcaattgcttggatcaaggcc
aatccaaaatctcagcagccttttgatgtaaagggctacaaaatcccgggtggcgatcca
aaaactccagcagttgcacaagttcttgcaattgcgccagccatgttaagagacaaaact
aaaggttgttaccctgcccctgaagcaattatggctgccgcagttgaaggtgctcaagtt
gatgtcgatactgcactgcgtattgagtctcgatactttactcagcttaccacaggccaa
atttctaaaaatatgatcggtacattctggcatggtttaaatgcaattaagtctggtgct
agccgtcctgccgacgttgcaaaatggcaagccacgaaagtgggtgtgttgggcgcaggc
atgatgggtgcaggcattgcttattcaacagccattaaaggcattccagttgtacttaaa
gatgtatctgttgaaaatgctgagaaaggcaaagcatattctcagaaattgctagataaa
cgtgtttcacaaggccgcatgacggcagaaaaacgtgatcaggttttatcgctcattacg
gctacagcttctgctgaagatcttcaaggttgtgatttaattattgaagccgtatttgag
aatcaagaactcaaggcgaaagtcactcaagaagccgagcaatatctagcacctaacggt
gtgatggcatcaaacacctcaaccctgccaattacaggtttagcgcaagcaagtaaggat
gataaagcttttatcggtctgcatttctttagccctgtcgacaaaatgcagttggttgag
attattaaaggtaaaaacacctccgcagagacacttgccaaagcttacgactttgtacaa
caaattggaaaaacaccgattgttgtcaatgatagccgtggtttctttaccagtcgtgtg
tttggtactttcattcaagaaggtatgcgcttgcttgccgaaggcgtccacccagcgcgt
attgaaatggctgcactgaaagcgggtatgccagttggccccctcgctattcaagatgaa
gtgtctttaaccttaactgagcatgttgctagtgaagcacgcaaagctctacaagccgaa
ggaaaagatttacctaaaacttctgtagatgaagtggttcacaccatgattcatgagtta
aaccgtaaaggtaaagctgctggagctggtttttatgaataccctgaaaatggtaaaaag
catctatgggaaggcttaaaccgctggaaaaaagatcatgatatttctgaacaagatatg
attgatcgcattctgtttgtacaggccttagatactttacgttgttatgaagaaggcgta
ttggagtctgtaattgatgccaatgtcggttctatctttgggattggttatgcaccttgg
actggaggagcaattcaattcctaaatcagtatggtactgataaagcacaaaaacgtgcc
gaagaattagctgccaaatatggtgaacgtttcacaccgccagctttactaaaaaccaaa
gctgagcagaaacaaaatattcagtaa

DBGET integrated database retrieval system