KEGG   Acinetobacter calcoaceticus: BDGL_002315Help
Entry
BDGL_002315       CDS       T01684                                 

Gene name
fadJ
Definition
putative 3-hydroxybutyryl-CoA epimerase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
acc  Acinetobacter calcoaceticus
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:acc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BDGL_002315 (fadJ)
   01212 Fatty acid metabolism
    BDGL_002315 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BDGL_002315 (fadJ)
   00650 Butanoate metabolism
    BDGL_002315 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    BDGL_002315 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    BDGL_002315 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BDGL_002315 (fadJ)
   00310 Lysine degradation
    BDGL_002315 (fadJ)
   00380 Tryptophan metabolism
    BDGL_002315 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BDGL_002315 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BDGL_002315 (fadJ)
   00281 Geraniol degradation
    BDGL_002315 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    BDGL_002315 (fadJ)
Enzymes [BR:acc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BDGL_002315 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BDGL_002315 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BDGL_002315 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2510490..2512376
Genome map
AA seq 628 aa AA seqDB search
MVEKLKGHLRTIETLGIPVVAALNGTALGGGWEIALSCHHRIAINDPKSKFGLPEVTLGL
LPGGGGIVRMVRLLGLQNAFPFLMEGKQFGVDKAKSLGLIHDTAENEQELLDKAIAWIKA
NPKSQQPFDVKGYKIPGGDPKTPAVAQVLAIAPAMLRDKTKGCYPAPEAIMAAAVEGAQV
DVDTALRIESRYFTQLTTGQISKNMIGTFWHGLNAIKSGASRPADVAKWQATKVGVLGAG
MMGAGIAYSTAIKGIPVVLKDVSVENAEKGKAYSQKLLDKRVSQGRMTAEKRDQVLSLIT
ATASAEDLQGCDLIIEAVFENQELKAKVTQEAEQYLAPNGVMASNTSTLPITGLAQASKD
DKAFIGLHFFSPVDKMQLVEIIKGKNTSAETLAKAYDFVQQIGKTPIVVNDSRGFFTSRV
FGTFIQEGMRLLAEGVHPARIEMAALKAGMPVGPLAIQDEVSLTLTEHVASEARKALQAE
GKDLPKTSVDEVVHTMIHELNRKGKAAGAGFYEYPENGKKHLWEGLNRWKKDHDISEQDM
IDRILFVQALDTLRCYEEGVLESVIDANVGSIFGIGYAPWTGGAIQFLNQYGTDKAQKRA
EELAAKYGERFTPPALLKTKAEQKQNIQ
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggttgaaaagctaaaaggtcatttacgtacaattgaaacgcttggtattccagtcgtt
gcagcattaaatggtactgcacttggcggtggttgggaaattgcattaagttgccatcac
cgtattgcaatcaatgacccgaaaagcaaatttggcttaccagaagttactttaggtttg
ttaccaggcggcggtggtattgtacgtatggtacgtttgcttgggcttcaaaatgcattt
cctttcttaatggaaggcaaacagttcggtgttgataaagcaaaatctttaggtttaatt
catgacactgccgaaaatgagcaagaacttttagataaagcaattgcttggatcaaggcc
aatccaaaatctcagcagccttttgatgtaaagggctacaaaatcccgggtggcgatcca
aaaactccagcagttgcacaagttcttgcaattgcgccagccatgttaagagacaaaact
aaaggttgttaccctgcccctgaagcaattatggctgccgcagttgaaggtgctcaagtt
gatgtcgatactgcactgcgtattgagtctcgatactttactcagcttaccacaggccaa
atttctaaaaatatgatcggtacattctggcatggtttaaatgcaattaagtctggtgct
agccgtcctgccgacgttgcaaaatggcaagccacgaaagtgggtgtgttgggcgcaggc
atgatgggtgcaggcattgcttattcaacagccattaaaggcattccagttgtacttaaa
gatgtatctgttgaaaatgctgagaaaggcaaagcatattctcagaaattgctagataaa
cgtgtttcacaaggccgcatgacggcagaaaaacgtgatcaggttttatcgctcattacg
gctacagcttctgctgaagatcttcaaggttgtgatttaattattgaagccgtatttgag
aatcaagaactcaaggcgaaagtcactcaagaagccgagcaatatctagcacctaacggt
gtgatggcatcaaacacctcaaccctgccaattacaggtttagcgcaagcaagtaaggat
gataaagcttttatcggtctgcatttctttagccctgtcgacaaaatgcagttggttgag
attattaaaggtaaaaacacctccgcagagacacttgccaaagcttacgactttgtacaa
caaattggaaaaacaccgattgttgtcaatgatagccgtggtttctttaccagtcgtgtg
tttggtactttcattcaagaaggtatgcgcttgcttgccgaaggcgtccacccagcgcgt
attgaaatggctgcactgaaagcgggtatgccagttggccccctcgctattcaagatgaa
gtgtctttaaccttaactgagcatgttgctagtgaagcacgcaaagctctacaagccgaa
ggaaaagatttacctaaaacttctgtagatgaagtggttcacaccatgattcatgagtta
aaccgtaaaggtaaagctgctggagctggtttttatgaataccctgaaaatggtaaaaag
catctatgggaaggcttaaaccgctggaaaaaagatcatgatatttctgaacaagatatg
attgatcgcattctgtttgtacaggccttagatactttacgttgttatgaagaaggcgta
ttggagtctgtaattgatgccaatgtcggttctatctttgggattggttatgcaccttgg
actggaggagcaattcaattcctaaatcagtatggtactgataaagcacaaaaacgtgcc
gaagaattagctgccaaatatggtgaacgtttcacaccgccagctttactaaaaaccaaa
gctgagcagaaacaaaatattcagtaa

DBGET integrated database retrieval system