KEGG   Acinetobacter pittii: BDGL_002330Help
Entry
BDGL_002330       CDS       T01684                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
acc  Acinetobacter pittii
Pathway
acc00260  Glycine, serine and threonine metabolism
acc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
acc01100  Metabolic pathways
acc01110  Biosynthesis of secondary metabolites
acc01130  Biosynthesis of antibiotics
acc01230  Biosynthesis of amino acids
Module
acc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:acc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BDGL_002330 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BDGL_002330 (trpA)
Enzymes [BR:acc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BDGL_002330 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB Dus
Motif
Other DBs
NCBI-GeneID: 11636861
NCBI-ProteinID: YP_004996598
UniProt: F0KNU1
Position
complement(2526794..2527480)
Genome map
AA seq 228 aa AA seqDB search
MVAAGVDVIELGLPFSDPMADGPVIALAAERALAAGTNTLDALNMVKEFREQDQETPVVL
MGYLNPVEVIGYEKFVSHAKQCGVDGLLLVDLPPEESKEFGAVLKQHDMDQIFLLAPTST
DQRIQHVTNQASGFIYYVSLKGVTGAATLDTAEAAARIQKIKNATNIPVGVGFGISDAAS
AKAMGNVADAVIVGSAFVKNFATLAADDAVEQTVSKVKELRAALDELV
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggttgcggcaggagtagatgtcattgagcttggtctaccattttcagatccaatggct
gatggtccggtaattgcgcttgcagctgaacgtgcgcttgcagcaggaactaacacgttg
gatgcactcaacatggtaaaagagttccgtgagcaggatcaggaaacacctgttgtttta
atgggttatctgaatccggttgaagtgattggttacgagaagtttgtttctcatgcgaaa
caatgtggtgtagatggcttattacttgtggatttaccaccagaagagtcaaaagagttt
ggtgctgtgttgaaacaacatgatatggaccaaattttcttgcttgcgccaacttctaca
gatcaacgcattcaacatgtgactaatcaggcaagtggttttatttactacgtttcactt
aagggtgtaactggagcagcaacacttgatacggcagaagctgctgcgcgtattcaaaaa
atcaaaaatgccactaatattccagtgggtgttggttttggtattagtgatgccgcttca
gcaaaagcaatgggtaatgttgctgatgccgtgattgtgggtagtgctttcgttaaaaat
tttgcaacgttggcagcggatgacgctgttgaacagacggtgagtaaagtcaaggagctt
cgagcagcgctcgatgagttagtatga

DBGET integrated database retrieval system