KEGG   Acinetobacter pittii: BDGL_002335Help
Entry
BDGL_002335       CDS       T01684                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
acc  Acinetobacter pittii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:acc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BDGL_002335 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BDGL_002335 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BDGL_002335 (trpB)
Enzymes [BR:acc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BDGL_002335 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(2531435..2532664)
Genome map
AA seq 409 aa AA seqDB search
MDQQNNVIDYTQYPDAAGHFGIHGGRFVSETLMAALEDLENLYSRMKNDEQFLAEFDRDL
AYYVGRPSPLYYAERWSKELGGAQIYLKREDLNHTGSHKVNNTIGQALLAKLSGKKRIIA
ETGAGQHGVATATIAARLGLECVVYMGAEDVKRQAMNVYRMRLLGATVVPVQSGSKTLKD
AMNEAMRDWVTNVDTTYYVIGTVAGPHPYPQLVRDFQSIIGREARKQILEQAGRLPDALV
ACVGGGSNAMGLFYPFLNDANVKMYGVEAAGFGIETGKHSAPLNAGHVGVLHGNRTYLMS
DEQGQIIETHSISAGLDYPGVGPEHSFLKDMKRVEYVPINDTEALQGFRDLTKIEGIIPA
LESSHAMAYVSKLAPTMSKDQIIIATVSGRGDKDLMTVARIDGVEMVEM
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtggatcagcaaaacaatgtgattgactatacacagtacccagatgctgcagggcatttc
ggtatccatggcggacgttttgtgtcagaaactctaatggcggcattagaagatttagaa
aatctctattcccgcatgaaaaatgatgaacagtttttggcagaattcgaccgtgacctc
gcctactatgtaggtcgtcctagtccactttattatgctgagcgatggtcaaaagagtta
ggtggtgcgcaaatttaccttaaacgtgaagacttgaaccatacaggctcacacaaagta
aacaacacgattggtcaggcgttattggcaaagctttctggtaaaaaacgtattattgcc
gaaactggtgctgggcagcatggtgtcgcaacagcaacaattgcagcacgtttaggtctc
gaatgtgttgtttatatgggcgctgaagacgttaagcgtcaagccatgaacgtttatcgt
atgcgtttgttgggtgctacagttgttcctgtacaaagcggctctaaaacgctgaaagat
gccatgaacgaagcgatgcgtgattgggtaactaatgttgatacgacgtactatgtaatt
ggtacagttgcaggcccgcatccatatcctcaattggttcgtgactttcagtcaattatt
ggtcgtgaagcgcgtaaacagattttggaacaagcaggtcgtttaccagatgcattagtt
gcctgtgtaggtggtggttcaaatgcaatgggcttgttctatccattcttaaacgatgcc
aacgtgaaaatgtatggtgttgaagcagctggttttggtattgaaactggaaaacactct
gcgccgttaaatgcaggtcacgtgggtgtattacatggtaaccgtacttacttgatgagt
gatgaacaaggtcagattattgagacacatagtatctcagctggtcttgactatccgggt
gtcggtcctgagcatagcttcttgaaagatatgaagcgcgtagaatacgtgccgattaat
gatacagaagctttgcaaggttttcgtgatttaaccaaaatcgaagggattattcctgcg
cttgaaagctcgcatgcgatggcttatgtctctaagcttgcaccgacgatgtctaaagat
cagattattattgcgactgtttcaggtcgtggtgataaagatttaatgacagttgcacgt
attgatggcgtagaaatggtcgagatgtaa

DBGET integrated database retrieval system