KEGG   Acinetobacter calcoaceticus: BDGL_002335Help
Entry
BDGL_002335       CDS       T01684                                 

Gene name
trpB
Definition
tryptophan synthase beta chain
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
acc  Acinetobacter calcoaceticus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:acc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BDGL_002335 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BDGL_002335 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BDGL_002335 (trpB)
Enzymes [BR:acc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BDGL_002335 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2531435..2532664)
Genome map
AA seq 409 aa AA seqDB search
MDQQNNVIDYTQYPDAAGHFGIHGGRFVSETLMAALEDLENLYSRMKNDEQFLAEFDRDL
AYYVGRPSPLYYAERWSKELGGAQIYLKREDLNHTGSHKVNNTIGQALLAKLSGKKRIIA
ETGAGQHGVATATIAARLGLECVVYMGAEDVKRQAMNVYRMRLLGATVVPVQSGSKTLKD
AMNEAMRDWVTNVDTTYYVIGTVAGPHPYPQLVRDFQSIIGREARKQILEQAGRLPDALV
ACVGGGSNAMGLFYPFLNDANVKMYGVEAAGFGIETGKHSAPLNAGHVGVLHGNRTYLMS
DEQGQIIETHSISAGLDYPGVGPEHSFLKDMKRVEYVPINDTEALQGFRDLTKIEGIIPA
LESSHAMAYVSKLAPTMSKDQIIIATVSGRGDKDLMTVARIDGVEMVEM
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtggatcagcaaaacaatgtgattgactatacacagtacccagatgctgcagggcatttc
ggtatccatggcggacgttttgtgtcagaaactctaatggcggcattagaagatttagaa
aatctctattcccgcatgaaaaatgatgaacagtttttggcagaattcgaccgtgacctc
gcctactatgtaggtcgtcctagtccactttattatgctgagcgatggtcaaaagagtta
ggtggtgcgcaaatttaccttaaacgtgaagacttgaaccatacaggctcacacaaagta
aacaacacgattggtcaggcgttattggcaaagctttctggtaaaaaacgtattattgcc
gaaactggtgctgggcagcatggtgtcgcaacagcaacaattgcagcacgtttaggtctc
gaatgtgttgtttatatgggcgctgaagacgttaagcgtcaagccatgaacgtttatcgt
atgcgtttgttgggtgctacagttgttcctgtacaaagcggctctaaaacgctgaaagat
gccatgaacgaagcgatgcgtgattgggtaactaatgttgatacgacgtactatgtaatt
ggtacagttgcaggcccgcatccatatcctcaattggttcgtgactttcagtcaattatt
ggtcgtgaagcgcgtaaacagattttggaacaagcaggtcgtttaccagatgcattagtt
gcctgtgtaggtggtggttcaaatgcaatgggcttgttctatccattcttaaacgatgcc
aacgtgaaaatgtatggtgttgaagcagctggttttggtattgaaactggaaaacactct
gcgccgttaaatgcaggtcacgtgggtgtattacatggtaaccgtacttacttgatgagt
gatgaacaaggtcagattattgagacacatagtatctcagctggtcttgactatccgggt
gtcggtcctgagcatagcttcttgaaagatatgaagcgcgtagaatacgtgccgattaat
gatacagaagctttgcaaggttttcgtgatttaaccaaaatcgaagggattattcctgcg
cttgaaagctcgcatgcgatggcttatgtctctaagcttgcaccgacgatgtctaaagat
cagattattattgcgactgtttcaggtcgtggtgataaagatttaatgacagttgcacgt
attgatggcgtagaaatggtcgagatgtaa

DBGET integrated database retrieval system