KEGG   Acinetobacter calcoaceticus: BDGL_002341Help
Entry
BDGL_002341       CDS       T01684                                 

Gene name
olE1
Definition
putative fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
acc  Acinetobacter calcoaceticus
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:acc00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BDGL_002341 (olE1)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BDGL_002341 (olE1)
Enzymes [BR:acc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     BDGL_002341 (olE1)
Lipid biosynthesis proteins [BR:acc01004]
 Desaturase
  First
   BDGL_002341 (olE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2537748..2538920
Genome map
AA seq 390 aa AA seqDB search
MTSAPLKAPINWTASITLIGLPILAAIIIPIYAYYYDFSVSAWVSLFFLLALSSMGITAG
YHRLWAHRAYEASLPLKILLMIGGTFAVQNSILFWASGHRTHHRHVDDVDEDPYSIERGF
WYAHMGWMIRDHSPSEPDFKNAPDLLNDKLVMFQHKYYALLVVAVHVGILGLIGWATGDL
WGVVLLGGLLRLIISHQVTFFINSLCHMFGKRPYTDENSARDNFWLAIATWGEGYHNYHH
IFQYDYRNGVKWWQYDPTKWLIWSCSKIGLAKNLRRIPSFNIKKAELAMKFKYAEQDLAI
YGHDVNADITQMKQRIAQEYEAFTHTLNDWAKLKEQELQAKKAAMAEKIHRMDHKLKVDF
QLLEHRLSHHRECLETLMRSVKKNTNVVSD
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgacttccgccccactcaaagccccaattaactggaccgctagcattaccttaattggt
ttaccaattcttgccgcaatcataatcccgatttatgcgtattattatgattttagtgta
agcgcatgggtaagcttattttttcttttagctctaagtagtatggggattactgctggt
taccatcgcctttgggctcaccgagcttatgaagcgtcgttaccgcttaaaattctttta
atgatcggtggaacatttgccgtgcaaaatagtattttgttctgggcatctggtcaccgt
actcaccatcgacatgttgatgatgttgatgaagatccgtattcgattgagcgtggtttt
tggtatgcccatatgggttggatgatccgcgatcattcaccatctgagccagactttaaa
aatgcaccagacctactcaatgataaattggtcatgttccagcataaatattacgcgcta
cttgtagttgcagttcatgttggtattttaggtttaatcggttgggcaactggcgaccta
tggggtgtagtccttttaggtggtttgttacgtttaatcattagccatcaagttacattc
tttattaactcgctttgccatatgtttggtaaacgtccttatacagacgaaaactcagca
cgtgataatttctggttagccattgccacttggggcgagggttaccacaactatcaccat
atcttccaatacgactatcgtaatggtgtgaaatggtggcaatatgacccaacaaaatgg
ttaatctggtcatgttctaaaattggtttagctaaaaatttacgtcgtattccaagcttt
aatattaaaaaagcagaactggcgatgaaatttaaatacgctgaacaagacctcgctatt
tatggtcatgatgtaaatgcagacattactcaaatgaagcaacgtattgcacaagagtac
gaagcatttacacacacattaaatgattgggcaaaacttaaagaacaagagttacaagcg
aaaaaagcagcaatggctgaaaagattcatagaatggatcataagcttaaagttgatttc
caattgcttgaacaccgtttaagtcatcaccgcgaatgcttagaaacactgatgcgtagt
gttaaaaagaataccaacgtggtgtcagactaa

DBGET integrated database retrieval system