KEGG   Acinetobacter pittii: BDGL_002637Help
Entry
BDGL_002637       CDS       T01684                                 

Gene name
gmk
Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
acc  Acinetobacter pittii
Pathway
acc00230  Purine metabolism
acc01100  Metabolic pathways
Module
acc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:acc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BDGL_002637 (gmk)
Enzymes [BR:acc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BDGL_002637 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 AAA_33 MobB AAA_22 MLD AAA RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 11637276
NCBI-ProteinID: YP_004996905
UniProt: F0KFZ2
Position
2831663..2832292
Genome map
AA seq 209 aa AA seqDB search
MSGLLFVVSAASGTGKTSLVKALLDRVSNLHVSVSHTTRGQRPGELDGVHYHFTTKDEFL
DQVNHDGFIEYAEVFGNYYGTSQATVKQQLAQGHDVLLEIDWQGAEQVRKLFPESKQIFI
LPPTQFDLRQRLSNRGTDSVEVIEHRLSCAVEDMQHYTNFDYIIINDDFNKALHELEAVI
TANRLVLSQQAKRHQTLIQDLITPQPKQE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggtctattgtttgtcgtttctgctgcatcaggaacgggcaaaacatctttggtg
aaagccctgcttgaccgtgtgagcaatttacatgtttcagtctcgcatacaacccgaggt
caacgtcccggtgagttagatggtgttcactatcacttcactacgaaagatgaatttcta
gaccaagtcaaccatgatggctttatcgaatacgctgaagtatttggtaactactatggc
acttctcaagctacggtaaaacaacagttagctcaaggacacgatgtcttacttgaaatt
gattggcaaggtgcagaacaagtccgcaagcttttccctgaatccaagcaaatatttatt
ttacctccaactcaatttgatctacgtcagcgtttatctaatcgcggcactgactcagtt
gaagtcattgagcatcgtttaagctgtgcagtagaagatatgcagcactacacgaacttt
gattacatcattattaatgatgattttaataaagccttacatgagcttgaagctgtgatt
acagcgaaccgtttggtgctatctcagcaagcaaaacgtcatcaaactttaattcaagac
ttgattactcctcaaccaaaacaggaataa

DBGET integrated database retrieval system