KEGG   Acinetobacter calcoaceticus: BDGL_002890Help
Entry
BDGL_002890       CDS       T01684                                 

Gene name
pncA
Definition
bifunctional protein pncA
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
acc  Acinetobacter calcoaceticus
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:acc00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3105857..3106501)
Genome map
AA seq 214 aa AA seqDB search
MSMNKQPQNAALIVVDVQNGFTPGGNLAVADADTIIPTINQLAGCFENIVLTQDWHPDNH
ISFAQNHAGKQPFETIELDYGPQVLWPKHCVQGTQDAEFHPNLNIPTAQLIIRKGFHAHI
DSYSAFMEADHVTMTGLTGYLKERGIDTVYVVGIATDFCVAWTALDAVKQGFKTLVVEDA
CKGIDLNGSLEQAWQTMQQQGVVRTQSTDLLSKH
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgaataaacaaccacaaaatgcagctttaatcgtagttgatgtacaaaatggt
tttacaccgggtggaaacttggcagttgccgatgccgatacaattattccaacgattaac
caacttgctggttgttttgaaaatattgttctgacacaagattggcatcccgataatcat
atatcttttgcacaaaaccatgcgggcaaacagccatttgaaaccattgaactcgactat
gggccacaagtgctttggcctaagcattgtgtgcagggtactcaagatgccgaatttcat
ccgaatttaaatattccgaccgctcaactgattattcgaaagggttttcatgcgcatatt
gatagctactcggcttttatggaagcagatcacgtcaccatgaccggtttaacgggatac
ttaaaagagcgtggcattgatacggtttatgtggtcggaattgccacggacttttgtgtg
gcatggactgccttggatgcagttaaacaaggtttcaaaactttagtggttgaagatgct
tgtaaagggattgatctgaatggttcgttagaacaagcttggcaaaccatgcagcagcaa
ggtgttgtccgtactcagtcgactgatctgttgagtaagcactaa

DBGET integrated database retrieval system