KEGG   Acinetobacter calcoaceticus: BDGL_002984Help
Entry
BDGL_002984       CDS       T01684                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
acc  Acinetobacter calcoaceticus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BDGL_002984 (galU)
   00052 Galactose metabolism
    BDGL_002984 (galU)
   00500 Starch and sucrose metabolism
    BDGL_002984 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    BDGL_002984 (galU)
Enzymes [BR:acc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BDGL_002984 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3198839..3199714
Genome map
AA seq 291 aa AA seqDB search
MIKKAVLPVAGLGTRFLPASKSIPKEMVTVVDRPAIEYVVREAVDAGIEQIILVTHSSKA
SIENYFDRNFELETTLEQKKKFDLLAEITQIVPPHVSVVSVRQPQPLGLGHAVLCAKSIV
GQDDFAVLLPDVLVKDDSGRNDLSRMIARYNAVQAAQIMVEAVPDNLVDQYGIVDVAHSP
NEGESIAMQGIVEKPAVGSAPSNLSVVGRYILPAKIMQLLENTPKGAGNEIQLTDAIAML
QKTDIVEAYRMQGQTFDCGSKLGYLKAVLYYGIQHPKLGSEFKHLIQELKL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaagcagttttaccagtagctggtttaggtacacgttttttaccagcaagt
aagtcaattccaaaagaaatggtaacagttgttgaccgtccagctattgaatatgtagtg
cgtgaagcagttgatgctggaatagagcagattattttggtgactcactcttcaaaagca
tcgattgaaaattattttgatcgaaactttgaattagaaactacattagagcaaaaaaag
aaatttgatttacttgcagaaattacacaaattgttccaccccatgtgagtgttgtaagt
gtaagacaacctcagcctttagggttagggcatgcggttttatgtgcaaagagtattgtt
ggtcaagatgattttgctgtgttattaccggatgttttggtgaaagacgactcgggccga
aatgatttatctcgtatgattgcacgttataatgcagtgcaagctgcacagattatggta
gaagcagtacctgataaccttgtggatcaatacgggattgtagatgtagcacatagccct
aatgagggtgaaagtattgctatgcaaggcattgttgaaaaacctgctgttggctctgca
ccttctaatctttctgtagtgggtcgctatatattacctgcaaaaattatgcaacttttg
gaaaacacgccaaaaggtgcaggtaatgaaattcagttaacagatgcgattgcgatgtta
caaaaaacagatattgttgaagcctatcgtatgcaaggccaaacttttgactgcggtagt
aagcttggttatttaaaagctgtattatattatggaattcaacatcctaaattagggtca
gaatttaaacatttaattcaagaacttaagttgtag

DBGET integrated database retrieval system