KEGG   Acinetobacter calcoaceticus: BDGL_003030Help
Entry
BDGL_003030       CDS       T01684                                 

Gene name
acsA
Definition
putative acetyl-coA synthetase/AMP-(fatty) acid ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
acc  Acinetobacter calcoaceticus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:acc01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:acc00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:acc00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:acc00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:acc00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3252606..3253784
Genome map
AA seq 392 aa AA seqDB search
MMDYQNAAQTFDLESTAKQMLSGSLDALNACYECCDRHADGDKIALYWQGKDGRKEQYTF
RELKEWSSQFANFLKSQGVKVGDRISGLLPRTPELIVTIFAAWRIGAVYQPLFTAFGPKA
IEHRIQLAQSKLVVTDMGNRSKLDEIENCPAIMTVADAQGTPLKAGDFNFWNEVKQQSDQ
CDLVMRSIQNPFLLMFTSGTTGPAKPLEVPLKALIAFGRYMQDAIGLTEEDSFWNIADPG
WAYGLYYAITGPLFLGHATLFYEGGFSTDSLCQIVKDYKVNNLAGAPTAYRMMMAADPAQ
MAPLKGQFRVVSSAGEPLNPEVIRWFKQVLDAPIYDHYGQTEVGMVVCNHHGLEHEIHAG
SAGFQQVSQVRAIALLLSMNKVKNCRQIHREF
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgatggattatcaaaatgctgcacagactttcgatttggaaagcactgcaaaacagatg
ttatcaggttcacttgatgccttaaatgcttgttatgaatgctgtgatcgacacgcagat
ggcgacaaaattgcgctgtattggcaaggaaaagacggacgaaaagagcaatataccttc
cgtgaattaaaagagtggtcaagtcagtttgccaactttctaaaatcacaaggtgtaaaa
gtaggcgaccgtatttcaggtctattaccaagaacacctgaattgatcgtgactattttt
gcagcttggcgaattggtgcagtctatcaaccactctttactgcgtttggcccaaaagcg
attgagcaccgtattcagcttgcacaaagtaagctggtggtgaccgatatgggcaaccgt
agcaagcttgatgaaattgaaaattgccctgcaattatgactgtcgccgacgcacaaggt
actccccttaaagcaggcgattttaacttttggaatgaagtaaaacagcagtctgatcaa
tgtgatttggttatgcgtagcatccaaaatcctttcttgctcatgtttacttcaggcact
acagggccagctaaaccattggaagtgccattaaaagcactaattgcctttggtcgatat
atgcaagatgccattggtttaaccgaagaagattcgttttggaatattgccgatccgggt
tgggcgtatggtctgtactatgcgattactgggccgttattcttgggtcacgctactttg
ttttatgaaggtggttttagcacagatagcctatgccaaattgtgaaagattataaagtt
aacaacttggcaggtgcaccaacggcttaccgtatgatgatggcggctgatccagcacaa
atggcgcctttaaaagggcagttccgtgtagtgagcagtgctggtgaaccgctgaatcca
gaagtaatacgctggtttaaacaagtgcttgatgctccgatttatgaccactatgggcaa
actgaagtgggcatggtggtgtgtaatcatcatggtttagaacatgaaattcatgctggt
tcagcaggttttcagcaggtttcccaagtccgggctatcgcgttgctattgtcaatgaac
aaggtgaagaactgccgccagatacaccgggaattttag

DBGET integrated database retrieval system