KEGG   Acinetobacter pittii: BDGL_003030Help
Entry
BDGL_003030       CDS       T01684                                 

Gene name
acsA
Definition
(RefSeq) putative acetyl-coA synthetase/AMP-(fatty) acid ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
acc  Acinetobacter pittii
Pathway
acc00010  Glycolysis / Gluconeogenesis
acc00620  Pyruvate metabolism
acc00640  Propanoate metabolism
acc00680  Methane metabolism
acc01100  Metabolic pathways
acc01110  Biosynthesis of secondary metabolites
acc01120  Microbial metabolism in diverse environments
acc01130  Biosynthesis of antibiotics
acc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:acc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BDGL_003030 (acsA)
   00620 Pyruvate metabolism
    BDGL_003030 (acsA)
   00640 Propanoate metabolism
    BDGL_003030 (acsA)
  Energy metabolism
   00680 Methane metabolism
    BDGL_003030 (acsA)
Enzymes [BR:acc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BDGL_003030 (acsA)
Lipid biosynthesis proteins [BR:acc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BDGL_003030 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-GeneID: 11637677
NCBI-ProteinID: YP_004997298
UniProt: F0KJC1
Position
3252606..3253784
Genome map
AA seq 392 aa AA seqDB search
MMDYQNAAQTFDLESTAKQMLSGSLDALNACYECCDRHADGDKIALYWQGKDGRKEQYTF
RELKEWSSQFANFLKSQGVKVGDRISGLLPRTPELIVTIFAAWRIGAVYQPLFTAFGPKA
IEHRIQLAQSKLVVTDMGNRSKLDEIENCPAIMTVADAQGTPLKAGDFNFWNEVKQQSDQ
CDLVMRSIQNPFLLMFTSGTTGPAKPLEVPLKALIAFGRYMQDAIGLTEEDSFWNIADPG
WAYGLYYAITGPLFLGHATLFYEGGFSTDSLCQIVKDYKVNNLAGAPTAYRMMMAADPAQ
MAPLKGQFRVVSSAGEPLNPEVIRWFKQVLDAPIYDHYGQTEVGMVVCNHHGLEHEIHAG
SAGFQQVSQVRAIALLLSMNKVKNCRQIHREF
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgatggattatcaaaatgctgcacagactttcgatttggaaagcactgcaaaacagatg
ttatcaggttcacttgatgccttaaatgcttgttatgaatgctgtgatcgacacgcagat
ggcgacaaaattgcgctgtattggcaaggaaaagacggacgaaaagagcaatataccttc
cgtgaattaaaagagtggtcaagtcagtttgccaactttctaaaatcacaaggtgtaaaa
gtaggcgaccgtatttcaggtctattaccaagaacacctgaattgatcgtgactattttt
gcagcttggcgaattggtgcagtctatcaaccactctttactgcgtttggcccaaaagcg
attgagcaccgtattcagcttgcacaaagtaagctggtggtgaccgatatgggcaaccgt
agcaagcttgatgaaattgaaaattgccctgcaattatgactgtcgccgacgcacaaggt
actccccttaaagcaggcgattttaacttttggaatgaagtaaaacagcagtctgatcaa
tgtgatttggttatgcgtagcatccaaaatcctttcttgctcatgtttacttcaggcact
acagggccagctaaaccattggaagtgccattaaaagcactaattgcctttggtcgatat
atgcaagatgccattggtttaaccgaagaagattcgttttggaatattgccgatccgggt
tgggcgtatggtctgtactatgcgattactgggccgttattcttgggtcacgctactttg
ttttatgaaggtggttttagcacagatagcctatgccaaattgtgaaagattataaagtt
aacaacttggcaggtgcaccaacggcttaccgtatgatgatggcggctgatccagcacaa
atggcgcctttaaaagggcagttccgtgtagtgagcagtgctggtgaaccgctgaatcca
gaagtaatacgctggtttaaacaagtgcttgatgctccgatttatgaccactatgggcaa
actgaagtgggcatggtggtgtgtaatcatcatggtttagaacatgaaattcatgctggt
tcagcaggttttcagcaggtttcccaagtccgggctatcgcgttgctattgtcaatgaac
aaggtgaagaactgccgccagatacaccgggaattttag

DBGET integrated database retrieval system