KEGG   Acinetobacter calcoaceticus: BDGL_003033Help
Entry
BDGL_003033       CDS       T01684                                 

Gene name
fadB1
Definition
putative enoyl-CoA hydratase/isomerase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
acc  Acinetobacter calcoaceticus
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:acc00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BDGL_003033 (fadB1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BDGL_003033 (fadB1)
   00650 Butanoate metabolism
    BDGL_003033 (fadB1)
  Lipid metabolism
   00071 Fatty acid degradation
    BDGL_003033 (fadB1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BDGL_003033 (fadB1)
   00310 Lysine degradation
    BDGL_003033 (fadB1)
   00360 Phenylalanine metabolism
    BDGL_003033 (fadB1)
   00380 Tryptophan metabolism
    BDGL_003033 (fadB1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BDGL_003033 (fadB1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BDGL_003033 (fadB1)
   00281 Geraniol degradation
    BDGL_003033 (fadB1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BDGL_003033 (fadB1)
   00627 Aminobenzoate degradation
    BDGL_003033 (fadB1)
   00930 Caprolactam degradation
    BDGL_003033 (fadB1)
Enzymes [BR:acc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BDGL_003033 (fadB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3255427..3256200
Genome map
AA seq 257 aa AA seqDB search
MQWQSILLEKRNGVGLITLNRPQALNALNSELISEINQALDQLEKDREIGCIVLAGSEKA
FAAGADIKEMADLAFPDIYLDDFFHLADRIAQRRKPLIAAVSGYALGGGCELALMCDFIY
CADNAKFGLPEITLGVIPGIGGTQRLTHAIGKAKAMEMCLTARQMGAVEAEQSGLVARVF
TKEELLEQTLQAAEKIAARSLTANMMLKETINRAFEVNLTEGLRFERRMFHSIFATFDQK
EGMQAFVEKRKPNFKNQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcagtggcaaagtattttattagaaaagcgtaatggagttggactgattacattaaat
cgccctcaagcgctcaatgccttaaacagtgaattaattagtgaaattaatcaggcatta
gatcagctcgaaaaagatcgtgaaattggctgcatcgtattggcaggctcagaaaaagct
tttgccgcaggagctgacattaaagaaatggctgatttggcatttcctgatatttattta
gatgacttttttcatcttgcagatcgtattgcacagcgccgtaaacctctaattgcagcg
gtgagtggctatgcattgggtggtggctgtgagttggcgctgatgtgtgattttatttat
tgtgctgataacgccaagtttggtttacccgaaatcactttaggggtgattccgggtatt
ggtggcacacaacgcttaactcatgcgattggtaaagccaaagcaatggaaatgtgcctt
accgctcgtcaaatgggcgctgtagaagcagagcaaagtggtttagtcgcgcgtgtgttt
actaaagaagaattacttgaacaaaccttgcaagccgctgaaaaaatcgcagcacgctct
ttaactgcaaacatgatgcttaaagaaaccattaaccgagcttttgaagtaaaccttact
gaaggcttacgctttgaaagacgtatgttccattcaatttttgcaacatttgaccaaaaa
gaaggaatgcaggcgttcgttgaaaaacgaaaaccaaattttaaaaatcaataa

DBGET integrated database retrieval system