KEGG   Acinetobacter calcoaceticus: BDGL_003149Help
Entry
BDGL_003149       CDS       T01684                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase, pyridoxal-5'-phosphate-dependent enzyme
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
acc  Acinetobacter calcoaceticus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:acc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BDGL_003149 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BDGL_003149 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BDGL_003149 (thrC)
Enzymes [BR:acc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BDGL_003149 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3382606..3383745)
Genome map
AA seq 379 aa AA seqDB search
MSNANRYTGLVDRYRDRLPVSATTRAISLGEGNTPLIKLENIPRIIGKDVEIYVKYEGLN
PTGSFKDRGMTMAVTKAVEEGSKAIICASTGNTSAAAAAYAARAGIKAFVLIPEGKIAMG
KMAQAMMYGAITMQIRGNFDDGMRLVKEVADQAPVTIVNSINPYRLQGQKTIAYEIVEAL
GRAPDYHCLPVGNAGNITAHWMGYTEAVANQPADQFEQVIYDAATDQFTGPKPEGLPTMV
GYQASGAAPFLRGAPVESPETVATAIRIGNPQSWNHAKAVVRDSKGWFDELQDSEILEAQ
RLLSMYEGVFVEPASAASIGGAIRDIKAGKIAEGSVIVCTVTGNGLKDPDTAIKQCADAV
MLSIDATMDQVKDSILSNM
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatgccaatcgttatactggtcttgtagatcgttatcgtgaccgtttgccagtt
tcggcaactactcgtgctatctctttgggtgaaggcaacaccccactcattaaacttgag
aatattccacgtattattggcaaagatgttgaaatttatgtgaaatacgagggtttaaac
ccaactggttcatttaaagaccgtggtatgaccatggctgtaaccaaagcggttgaagaa
ggctctaaagcgattatctgtgcatctactggtaacacttctgctgctgctgctgcctat
gctgcacgtgcaggtatcaaagcattcgttttgattccagaaggcaagattgcgatgggt
aaaatggcgcaagcgatgatgtatggtgcgatcactatgcaaattcgtggtaacttcgat
gatggtatgcgtcttgtaaaagaagtcgctgatcaagcgcctgtaacgattgtaaactca
atcaacccttaccgtttgcaaggtcaaaagactattgcttatgaaatcgttgaagcttta
ggccgtgcacctgattaccactgcttacctgtaggtaatgcaggtaatatcaccgctcac
tggatgggttataccgaagctgtagcaaaccaacctgctgatcagtttgaacaagtgatt
tatgatgctgctactgatcaattcactggtccaaaaccagaaggtttaccaacaatggtg
ggttaccaagcttctggcgcagctccattcttacgtggcgctccagttgaaagccctgaa
actgttgcaactgcaatccgtattggtaatccacagagctggaaccatgcaaaagctgta
gtacgtgactctaaaggctggtttgatgaacttcaagacagcgaaattttagaagctcaa
cgcttactttctatgtatgaaggcgtatttgttgagccagcgtctgctgcttctatcggc
ggtgcgatccgtgatattaaagcgggtaaaattgctgaaggttctgtaattgtatgtaca
gtaactggtaatggcttgaaagatcctgacactgcaatcaaacaatgtgctgatgcagtg
atgttatcaattgatgcaacaatggaccaagtaaaagattcgattttatctaatatgtaa

DBGET integrated database retrieval system