KEGG   Acinetobacter calcoaceticus: BDGL_003151Help
Entry
BDGL_003151       CDS       T01684                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
acc  Acinetobacter calcoaceticus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3385345..3386160)
Genome map
AA seq 271 aa AA seqDB search
MSFTRSQLFLACALASSLLFSACSKENKPQKEDAFTATAPATGEASTIIERNAKQRLIET
LQKQFKNANINAKILDIKPTEVPNLYWVNLEGMTSIYTTSDGKYLIQGDVIRLGGKELHN
IGDNLQASENKKHLAALKNEDLIVYPAKGGKAKHVIYVFTDASCPYCHKLHEHLPEINEK
GIEVRYIAWPRGEQFMPTMEAVWCSADRKAAFNQAVQGINIPPAQCKNPVREQYQLGLNM
GVNGTPAIYNVDGEYLGGYLTPDELIKRLDK
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttacccgatctcaactttttcttgcctgtgctttggcttctagcctgttattc
agtgcttgttctaaagaaaacaaaccacaaaaagaagatgcgttcactgcgaccgcacct
gctactggggaagcttcaaccatcattgaacgcaatgctaaacagcgtttaattgaaact
ttgcaaaaacaatttaagaatgcaaacatcaacgccaaaattttagatatcaaacctact
gaagtgcctaacttatattgggtaaatctcgaaggaatgacgtcgatttatacaaccagt
gatggcaaatacctgattcaaggtgatgtcattcgtttaggcggtaaagaactgcataat
attggcgataatcttcaagcttcagaaaataaaaagcaccttgcagctttaaaaaatgaa
gatttgatcgtctacccagctaaaggtggtaaggctaaacatgtgatttatgtgtttacc
gatgcaagctgtccttattgccacaaattacatgagcatttacctgaaattaatgaaaaa
ggtattgaggtacgctatatcgcttggccacgcggtgaacaatttatgccgaccatggaa
gctgtatggtgtagtgcagaccgtaaagctgcatttaaccaagcagtacaaggtatcaat
atcccaccagctcaatgtaaaaaccctgtccgtgaacaatatcaacttggtttaaacatg
ggtgtaaatggaacaccggctatttataatgttgatggcgaatacttaggtggataccta
acaccggatgaattaattaaacgtctggataaataa

DBGET integrated database retrieval system