KEGG   Acinetobacter calcoaceticus: BDGL_003174Help
Entry
BDGL_003174       CDS       T01684                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
acc  Acinetobacter calcoaceticus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BDGL_003174 (hemD)
Enzymes [BR:acc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BDGL_003174 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3407823..3408590
Genome map
AA seq 255 aa AA seqDB search
MLFINTRPDSRAAELTEALQNEGYQVESLPLLELVAKPFSEHLLQLYQQLLKAQAIVVVS
PTAVEVGMEYLVKSGLKISDLKNIQWIAVGQATANCLNEYGIEAHIPDVETSEGMLNLPI
LHNMQQTGSVAFWRGEGGRQFMMETLQQQGIQILNFVLYHRQCPEASYSTFKHLTQNSNY
NLNKWLVLITSEASWKYWLELCSKNNVQPDGVYLVLGPRLFQIVKEYRDQQQAHFHIIQL
ENLSPSGMIHHIQAL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgctgtttattaatactcgacctgattcgcgtgcagctgaattaacagaagctttgcaa
aatgaaggttatcaggttgagtctttaccccttttagagcttgttgcaaaacccttttct
gaacacttacttcagctttaccaacaattacttaaagcacaagctattgttgtcgtcagc
ccaaccgctgttgaagtgggtatggagtatttagtaaaaagtggtttaaaaattagtgat
ttaaaaaatattcagtggattgcggtaggacaagcaacagccaattgtctaaacgaatat
ggaatagaagcacatatccctgatgttgaaacttctgaggggatgttgaacctgcctatt
ctgcacaatatgcaacagacgggtagtgtggctttttggcggggagagggcggacgtcaa
tttatgatggagaccttgcaacaacaaggaattcagattttaaattttgttctatatcat
cggcagtgcccagaagcttcatattctacattcaaacatctgacacagaattcaaattat
aatttaaataaatggctcgtcttaattaccagtgaagcgagctggaaatattggttagag
ctttgttcaaaaaataatgtacaacctgatggtgtatatctggttttaggacctcgtctt
tttcaaattgttaaagagtatcgcgatcagcaacaggctcattttcacattattcaactt
gaaaatttatcgccttcggggatgattcatcacattcaggcattataa

DBGET integrated database retrieval system