KEGG   Acinetobacter calcoaceticus: BDGL_003212Help
Entry
BDGL_003212       CDS       T01684                                 

Gene name
fadB
Definition
fatty oxidation complex alpha subunit
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
acc  Acinetobacter calcoaceticus
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:acc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BDGL_003212 (fadB)
   01212 Fatty acid metabolism
    BDGL_003212 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BDGL_003212 (fadB)
   00650 Butanoate metabolism
    BDGL_003212 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    BDGL_003212 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    BDGL_003212 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BDGL_003212 (fadB)
   00310 Lysine degradation
    BDGL_003212 (fadB)
   00380 Tryptophan metabolism
    BDGL_003212 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BDGL_003212 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BDGL_003212 (fadB)
   00281 Geraniol degradation
    BDGL_003212 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    BDGL_003212 (fadB)
Enzymes [BR:acc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BDGL_003212 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BDGL_003212 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BDGL_003212 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     BDGL_003212 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3450989..3453142)
Genome map
AA seq 717 aa AA seqDB search
MIHAGNAITVQMLSDGIAEFRFDLQGESVNKFNRATIEDFQAAIAAVKANNDIKGLVVTS
GKSTFIVGADITEFGENFAQGEKAIVDWLMPVHEIFNSFEDLEIPKVVAINGMALGGGFE
MCLVCDYRVMSEAAQVGLPEIKLGIYPGFGGSVRLSRLIGIDNAVEWMAMAAPKKPAAAL
KDGAVDAVVAADKLLEAATDLVKQAISGRLNWKAKRQEKLEAVKLNPLEQMMAFNTAKGA
VLAKANPAQYPAPKLLLDSLQAGASLARDEALKAEAEGFAKAAITPQAGALIGLFLNDQV
VKKTAKKYEKGAHPVNQAAVLGAGIMGGGIAYQAASKGTPIIMKDIGNPQLALGMKEANS
LLTKQVERKKMKPAQMGETLARIRPTLSYDEFKEVDIVIEAVTENPKVKEIVLADTEKNV
RENTIIASNTSTISITRLAKALQRPENFVGMHFFNPVHMMPLVEVIRGEKTSEEAIATTV
VLAQKMGKTPIVVNDCPGFLVNRVLFPYFGAFDLLVKDGADFQQVDNVMSKFGWPMGPAY
LIDVVGIDTGVHGAEVMAEGFPDRMKPDYKGSIQAMYEAKRLGQKNDVGFYKYELDKKGK
KAKTVDPTAYEIIAPFVTGEKREFDNQEIIDRMMLAFCNETVRCLEDNIVATAAEADMAM
IMGVGFPPFRGGPCRYIDQTGVAEYVALCDKYAHLGKAYEAPQMLRDMAANNKKFYG
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgatccacgctggcaatgccattaccgtccaaatgctttcggacggaattgcagaattc
cgctttgacttacaaggtgagtcggtcaataaatttaaccgtgcaacaattgaagatttc
caagctgctattgctgcggtaaaagcaaataatgatattaaaggcttagttgttacctcg
ggcaaatcgacatttattgttggggcagacattaccgaatttggtgaaaacttcgcacaa
ggcgaaaaagcaattgttgactggcttatgcctgttcacgaaatcttcaatagctttgaa
gatttagagattccaaaagttgttgctattaacggtatggcgttaggcggcggttttgaa
atgtgtttagtttgtgactatcgtgtgatgtcagaagctgcacaagtgggcttaccggaa
attaaacttggtatttacccaggttttggcggtagcgtacgtttaagccgtctgatcggt
atcgacaacgcggttgaatggatggcgatggctgctcctaaaaaaccggctgctgctcta
aaagatggtgctgtagatgcggttgtagctgctgataaattacttgaagctgcaactgac
ttggttaagcaagcaatttctggtcgtttaaactggaaagcaaaacgtcaagaaaagctt
gaagctgtaaaattgaatccgcttgaacaaatgatggcgttcaatactgcaaaaggtgca
gtgcttgctaaagcaaaccctgctcaataccctgctccaaaattattacttgattcatta
caagcgggtgcaagccttgcgcgtgacgaagcattaaaagctgaagcggaaggttttgca
aaagctgcgattacgccacaagctggtgcattgattggtttattcctcaatgaccaagtt
gttaagaaaactgctaaaaaatatgaaaaaggtgcacaccctgtaaaccaagcggctgta
cttggcgctggtatcatgggtggtggtattgcttaccaagcggcaagcaaaggtacacca
attatcatgaaagatattggtaatccacaacttgctttaggtatgaaagaagcgaacagc
ttgttaactaaacaagttgaacgtaagaaaatgaaacctgcgcaaatgggtgaaacactt
gcacgtatccgtcctactttaagctacgatgagtttaaagaagttgatatcgtgatcgaa
gcagttacagaaaatccaaaagtaaaagaaatcgttcttgcagacactgaaaagaatgtt
cgtgaaaatacgattattgcttctaatacttctacgatttcaatcacgcgtttagcaaaa
gcattacaacgtcctgaaaacttcgttggtatgcacttcttcaacccagttcacatgatg
ccgcttgtagaagtgattcgtggtgaaaagacttctgaagaagcgattgcaactactgtt
gttcttgctcaaaaaatgggtaaaacaccgatcgttgtaaatgactgcccaggattcttg
gttaaccgtgtattgttcccttactttggtgcgtttgaccttcttgtaaaagacggcgca
gacttccagcaagttgacaatgtaatgtctaagtttggctggccaatgggtcctgcttac
cttatcgacgttgtaggtatcgacacaggtgtacatggtgcagaagtcatggctgaaggt
ttcccagaccgtatgaagccagactacaaaggttcaatccaagcaatgtacgaagctaaa
cgtcttggtcaaaagaatgacgttggtttctacaaatacgaactcgataagaaaggcaaa
aaagcaaaaactgttgatccaacagcatatgaaatcattgctcctttcgtaacgggtgag
aaacgcgagtttgataaccaagaaatcattgaccgcatgatgcttgctttctgtaacgaa
acagttcgttgcttagaagacaacatcgttgcaactgctgctgaagcagacatggcaatg
attatgggtgtaggtttccctccattccgtggtggtccatgtcgttatatcgaccagact
ggtgttgctgaatacgttgcactttgcgacaaatatgcacacttaggtaaggcttatgaa
gcgccacaaatgttgcgcgacatggctgctaacaacaaaaaattctacggttaa

DBGET integrated database retrieval system