KEGG   Acinetobacter pittii: BDGL_003241Help
Entry
BDGL_003241       CDS       T01684                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
acc  Acinetobacter pittii
Pathway
acc00010  Glycolysis / Gluconeogenesis
acc00051  Fructose and mannose metabolism
acc00562  Inositol phosphate metabolism
acc01100  Metabolic pathways
acc01110  Biosynthesis of secondary metabolites
acc01120  Microbial metabolism in diverse environments
acc01130  Biosynthesis of antibiotics
acc01200  Carbon metabolism
acc01230  Biosynthesis of amino acids
Module
acc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:acc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BDGL_003241 (tpiA)
   00051 Fructose and mannose metabolism
    BDGL_003241 (tpiA)
   00562 Inositol phosphate metabolism
    BDGL_003241 (tpiA)
Enzymes [BR:acc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BDGL_003241 (tpiA)
Exosome [BR:acc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BDGL_003241 (tpiA)
  Exosomal proteins of bladder cancer cells
   BDGL_003241 (tpiA)
  Exosomal proteins of melanoma cells
   BDGL_003241 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 11637899
NCBI-ProteinID: YP_004997509
UniProt: F0KLB0
Position
3477838..3478641
Genome map
AA seq 267 aa AA seqDB search
MSRMSGSTITPWVVGNWKMNPMRANAKQLIEEFKQLLQQNQIADESCHVGVAPVSIALAM
VQTQLQDAARTVYTVAQDVSRVAGTGAYTGEVSAELLKDSQINFVLVGHSERRDIFGDNV
EILKAKLQNALNAGLTVIYCVGESLEQREQGLAEQVVLQQICDIAPVVTAEQWQKQIVIA
YEPIWAIGTGKTASPQDAQAMHAKIREGLSQITSAGSDIAILYGGSVKAENAVELAACPD
INGALVGGASLNAVSFYQIVQAFAQSK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgtatgtcgggttcgacgattacgccttgggtagttggcaactggaaaatgaac
ccaatgcgtgccaatgccaaacaacttatagaagaatttaaacaactattgcaacaaaac
caaattgcagatgaaagctgtcatgtaggggttgctccggtttctattgcgcttgcaatg
gtacaaacacaattgcaagatgctgcaagaacagtatatacagttgcacaagatgtatca
cgtgtagcgggtactggtgcgtatactggcgaagtcagcgcagaattattaaaagatagc
caaattaattttgtactggttgggcattctgagcgccgtgatatttttggcgacaacgtt
gaaattttgaaagctaaactccaaaatgcattaaatgcgggcttgactgtcatttattgt
gttggtgaaagcctcgaacaacgtgaacaaggtttggcagagcaagttgtattgcaacaa
atttgtgatattgctcctgtagttactgctgagcagtggcaaaagcaaattgtaattgct
tatgagccaatctgggcaattgggacaggtaaaactgcttctccacaagatgcacaggca
atgcatgctaagattcgtgaaggtttaagtcagattacctcagcgggttcagacattgcg
attttatatggcggtagtgtaaaagctgaaaatgcggtcgaattggcggcatgtccagat
attaatggtgcgttggtaggcggtgcttcactaaatgcagtatctttttatcaaattgta
caagcctttgcacaaagtaaataa

DBGET integrated database retrieval system