KEGG   Acinetobacter calcoaceticus: BDGL_003241Help
Entry
BDGL_003241       CDS       T01684                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
acc  Acinetobacter calcoaceticus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:acc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BDGL_003241 (tpiA)
   01230 Biosynthesis of amino acids
    BDGL_003241 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BDGL_003241 (tpiA)
   00051 Fructose and mannose metabolism
    BDGL_003241 (tpiA)
   00562 Inositol phosphate metabolism
    BDGL_003241 (tpiA)
Enzymes [BR:acc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BDGL_003241 (tpiA)
Exosome [BR:acc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BDGL_003241 (tpiA)
  Exosomal proteins of bladder cancer cells
   BDGL_003241 (tpiA)
  Exosomal proteins of melanoma cells
   BDGL_003241 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3477838..3478641
Genome map
AA seq 267 aa AA seqDB search
MSRMSGSTITPWVVGNWKMNPMRANAKQLIEEFKQLLQQNQIADESCHVGVAPVSIALAM
VQTQLQDAARTVYTVAQDVSRVAGTGAYTGEVSAELLKDSQINFVLVGHSERRDIFGDNV
EILKAKLQNALNAGLTVIYCVGESLEQREQGLAEQVVLQQICDIAPVVTAEQWQKQIVIA
YEPIWAIGTGKTASPQDAQAMHAKIREGLSQITSAGSDIAILYGGSVKAENAVELAACPD
INGALVGGASLNAVSFYQIVQAFAQSK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgtatgtcgggttcgacgattacgccttgggtagttggcaactggaaaatgaac
ccaatgcgtgccaatgccaaacaacttatagaagaatttaaacaactattgcaacaaaac
caaattgcagatgaaagctgtcatgtaggggttgctccggtttctattgcgcttgcaatg
gtacaaacacaattgcaagatgctgcaagaacagtatatacagttgcacaagatgtatca
cgtgtagcgggtactggtgcgtatactggcgaagtcagcgcagaattattaaaagatagc
caaattaattttgtactggttgggcattctgagcgccgtgatatttttggcgacaacgtt
gaaattttgaaagctaaactccaaaatgcattaaatgcgggcttgactgtcatttattgt
gttggtgaaagcctcgaacaacgtgaacaaggtttggcagagcaagttgtattgcaacaa
atttgtgatattgctcctgtagttactgctgagcagtggcaaaagcaaattgtaattgct
tatgagccaatctgggcaattgggacaggtaaaactgcttctccacaagatgcacaggca
atgcatgctaagattcgtgaaggtttaagtcagattacctcagcgggttcagacattgcg
attttatatggcggtagtgtaaaagctgaaaatgcggtcgaattggcggcatgtccagat
attaatggtgcgttggtaggcggtgcttcactaaatgcagtatctttttatcaaattgta
caagcctttgcacaaagtaaataa

DBGET integrated database retrieval system