KEGG   Acinetobacter calcoaceticus: BDGL_003268Help
Entry
BDGL_003268       CDS       T01684                                 

Gene name
recD
Definition
exonuclease V, alpha subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
acc  Acinetobacter calcoaceticus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:acc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BDGL_003268 (recD)
Enzymes [BR:acc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BDGL_003268 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3510864..3512615
Genome map
AA seq 583 aa AA seqDB search
MDNLNSPEQADLSWLTTWSNFLNQAPFTEQSQVSEATSYLQQLIEASLQGDSCIDISSEQ
IAALGQLAISADQATSKVAPCVYDEQGLALYRYWHLEQRLAEQICRLKQQLIQPVSCDDY
LDLLTDAHQQAALQMVARQSLSIITGGPGTGKTYTLARIIAVLSQAIPHIRVAMAAPTGK
AAQRMQEALQNSFNDPKLLESGLVSEELRNQGTQTIHRLLGMGHSQTPRFNQKQPLPYDV
IVVDEASMLDLNLATLLFEAVPESCRIILLGDANQLASVDVGAVLADLQQIQALADNRVQ
LQTSRRFAEGALIGQVAKFIQAQSYQQDHVEVLQRFEVDIVQVSELKPILLQRDMPDVVQ
LEYLPEGNHAEVEIYYQKLMLGFQGYVKSLKNYLKEERSIEQIQNVVKAFDDYRILTAVR
HGPFGLQQLNQYAQRWIQQQLSIVTLGGWYVGRPVMMTYNDYQLGISNGDIGLCFEHRTQ
PQQFEVYFPSLNKWVAANRLPKSIQSAFALTIHKSQGSEFTHTAVVLDQAAKNLLSQELI
YTAITRAKKVVSLLVHQEALLQAFTVRTTRKSGLVQKVNRLVR
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
gtggacaatctaaacagccctgaacaagccgatttaagctggttaacaacgtggagtaac
ttcttaaatcaggctccatttactgaacaatcgcaagtgtcagaagctacttcttacttg
cagcagcttattgaagcgagcttacaaggcgatagttgtatcgatatcagttcagagcaa
attgcagcacttggtcagcttgctatatctgccgatcaagcaacctcaaaagttgcgccg
tgcgtctacgatgagcaggggttggcattataccgatattggcacctagagcaacgactt
gcagaacaaatttgtcgattaaagcaacaattaattcaacctgtctcttgtgatgactat
ttagacctgcttaccgatgctcatcaacaggcagctttacaaatggttgctcggcagagc
ctgagtattattacgggtggaccgggtacaggtaagacttatacgctggcacgtatcatt
gctgtacttagccaagctattccacatattcgtgtggcgatggctgctccaacaggtaaa
gccgcacagcgcatgcaagaggccttacagaactcgtttaatgaccctaaattgcttgag
tctggattagtgagtgaagagctaaggaatcagggaacacaaacaattcaccgattattg
gggatgggacatagccagacaccacggtttaatcaaaaacagcctttgccttatgacgtg
attgtcgtggatgaagcttccatgctggatttaaatctggctactcttttatttgaagct
gtgcctgagtcttgtcgaattattttattaggagatgcaaatcagcttgcttccgttgat
gtcggggcggttcttgcagatttgcagcaaatacaggcgttggctgataaccgagtacaa
ttacaaaccagtcgtcgttttgctgaaggtgcattgattggacaagtggccaaatttatt
caggcacaaagctatcaacaagaccatgtagaggttttgcagcggtttgaagttgatatt
gttcaggtttcagaattaaagcccatacttttacaaagagatatgcctgatgttgttcag
cttgaatatttaccagaagggaatcacgcagaagtcgaaatttactatcagaagctcatg
ctcggtttccaagggtatgtaaaaagcctaaaaaattatttaaaagaagaacgctcgatt
gaacagatccaaaatgtagtaaaagcatttgatgactaccggattttaaccgcagttcgt
catggtccgtttggattgcagcagttaaatcaatatgcgcagcgttggatacagcaacaa
ctttcaatagtgactcttggtggatggtacgtgggtcgtcctgtaatgatgacttataac
gattatcagctcggtatttcaaatggtgatattggtttgtgttttgagcacagaactcag
ccacagcagtttgaagtatattttccaagtttgaacaaatgggttgctgcaaatcgatta
ccaaaaagtattcaaagtgcatttgccttaacaattcataaatcgcaagggtctgaattt
acccatactgctgtcgttttagatcaggctgccaagaacttattaagccaagaacttatt
tacactgcgattacacgagctaagaaagtagtcagtcttttagtgcatcaagaggcttta
ttacaagcatttacagttcgtactacacgaaaaagcggtttagttcaaaaagttaatcgg
ttagttcgttaa

DBGET integrated database retrieval system