KEGG   Acinetobacter calcoaceticus: BDGL_003268Help
Entry
BDGL_003268       CDS       T01684                                 

Gene name
recD
Definition
exonuclease V, alpha subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
acc  Acinetobacter calcoaceticus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:acc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3510864..3512615
Genome map
AA seq 583 aa AA seqDB search
MDNLNSPEQADLSWLTTWSNFLNQAPFTEQSQVSEATSYLQQLIEASLQGDSCIDISSEQ
IAALGQLAISADQATSKVAPCVYDEQGLALYRYWHLEQRLAEQICRLKQQLIQPVSCDDY
LDLLTDAHQQAALQMVARQSLSIITGGPGTGKTYTLARIIAVLSQAIPHIRVAMAAPTGK
AAQRMQEALQNSFNDPKLLESGLVSEELRNQGTQTIHRLLGMGHSQTPRFNQKQPLPYDV
IVVDEASMLDLNLATLLFEAVPESCRIILLGDANQLASVDVGAVLADLQQIQALADNRVQ
LQTSRRFAEGALIGQVAKFIQAQSYQQDHVEVLQRFEVDIVQVSELKPILLQRDMPDVVQ
LEYLPEGNHAEVEIYYQKLMLGFQGYVKSLKNYLKEERSIEQIQNVVKAFDDYRILTAVR
HGPFGLQQLNQYAQRWIQQQLSIVTLGGWYVGRPVMMTYNDYQLGISNGDIGLCFEHRTQ
PQQFEVYFPSLNKWVAANRLPKSIQSAFALTIHKSQGSEFTHTAVVLDQAAKNLLSQELI
YTAITRAKKVVSLLVHQEALLQAFTVRTTRKSGLVQKVNRLVR
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
gtggacaatctaaacagccctgaacaagccgatttaagctggttaacaacgtggagtaac
ttcttaaatcaggctccatttactgaacaatcgcaagtgtcagaagctacttcttacttg
cagcagcttattgaagcgagcttacaaggcgatagttgtatcgatatcagttcagagcaa
attgcagcacttggtcagcttgctatatctgccgatcaagcaacctcaaaagttgcgccg
tgcgtctacgatgagcaggggttggcattataccgatattggcacctagagcaacgactt
gcagaacaaatttgtcgattaaagcaacaattaattcaacctgtctcttgtgatgactat
ttagacctgcttaccgatgctcatcaacaggcagctttacaaatggttgctcggcagagc
ctgagtattattacgggtggaccgggtacaggtaagacttatacgctggcacgtatcatt
gctgtacttagccaagctattccacatattcgtgtggcgatggctgctccaacaggtaaa
gccgcacagcgcatgcaagaggccttacagaactcgtttaatgaccctaaattgcttgag
tctggattagtgagtgaagagctaaggaatcagggaacacaaacaattcaccgattattg
gggatgggacatagccagacaccacggtttaatcaaaaacagcctttgccttatgacgtg
attgtcgtggatgaagcttccatgctggatttaaatctggctactcttttatttgaagct
gtgcctgagtcttgtcgaattattttattaggagatgcaaatcagcttgcttccgttgat
gtcggggcggttcttgcagatttgcagcaaatacaggcgttggctgataaccgagtacaa
ttacaaaccagtcgtcgttttgctgaaggtgcattgattggacaagtggccaaatttatt
caggcacaaagctatcaacaagaccatgtagaggttttgcagcggtttgaagttgatatt
gttcaggtttcagaattaaagcccatacttttacaaagagatatgcctgatgttgttcag
cttgaatatttaccagaagggaatcacgcagaagtcgaaatttactatcagaagctcatg
ctcggtttccaagggtatgtaaaaagcctaaaaaattatttaaaagaagaacgctcgatt
gaacagatccaaaatgtagtaaaagcatttgatgactaccggattttaaccgcagttcgt
catggtccgtttggattgcagcagttaaatcaatatgcgcagcgttggatacagcaacaa
ctttcaatagtgactcttggtggatggtacgtgggtcgtcctgtaatgatgacttataac
gattatcagctcggtatttcaaatggtgatattggtttgtgttttgagcacagaactcag
ccacagcagtttgaagtatattttccaagtttgaacaaatgggttgctgcaaatcgatta
ccaaaaagtattcaaagtgcatttgccttaacaattcataaatcgcaagggtctgaattt
acccatactgctgtcgttttagatcaggctgccaagaacttattaagccaagaacttatt
tacactgcgattacacgagctaagaaagtagtcagtcttttagtgcatcaagaggcttta
ttacaagcatttacagttcgtactacacgaaaaagcggtttagttcaaaaagttaatcgg
ttagttcgttaa

DBGET integrated database retrieval system