KEGG   Acinetobacter calcoaceticus: BDGL_003491Help
Entry
BDGL_003491       CDS       T01684                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
acc  Acinetobacter calcoaceticus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:acc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3749704..3750186
Genome map
AA seq 160 aa AA seqDB search
MTTKTYIGLGSNLGDSRQILSEAIAKLKTLGGVKVSKLYQSPPMGPQDQPNYLNAVAELN
TDLMPLDLLDQLQRFEQEAGRVRLRRWGERTLDLDLLIYGDEKIQNERLTVPHIGILERD
FVVIPLLDLDADLHINDQPLKNLELIQQPTLTVLADESWA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgaagacctatattggtttaggaagtaatttgggtgattcgcgccaaatctta
tctgaagccattgctaagcttaaaactttaggtggagtgaaagtttctaaactttatcaa
agtccacctatggggcctcaagatcaaccaaattatttaaatgcagttgcagagctaaat
acggatctcatgcctttagatttgttagaccagttacaacgatttgagcaagaagctggt
cgtgtacgccttcgtcgttggggagagcgtaccttagatctagatttgcttatatatggt
gatgaaaaaattcaaaatgagcgcttaactgtgccacacattggaattctagagcgagat
ttcgttgtaattcctttattagatttagacgctgatttacatattaacgatcagccactt
aaaaatttagaactcatacagcagcctacgctgactgtacttgctgatgagtcttgggct
taa

DBGET integrated database retrieval system