KEGG   Acinetobacter oleivorans: AOLE_00280Help
Entry
AOLE_00280        CDS       T01263                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
acd  Acinetobacter oleivorans
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    AOLE_00280
Enzymes [BR:acd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     AOLE_00280
    3.5.1.-  
     AOLE_00280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
66679..67323
Genome map
AA seq 214 aa AA seqDB search
MNMNKQPQNAVLIVVDVQNGFTPGGNLAVADADTIIPTINQLADCFENVVLTQDWHPDNH
ISFAQNHSGKQPFETIELDYGPQVLWPKHCVQGTHDAEFHPSLNIPTAQLIIRKGFHAHI
DSYSAFMEADHATMTGLTGYLKERGIDTVYVVGIATDFCVAWTALDAVKQGFKTLVIEDA
CKAIDLDGSLEHAWQTMQQQEVVRIQSTDLLSGR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgaataaacaaccacaaaatgcggttttaatcgtagttgatgtgcaaaatggt
tttacaccgggtggaaatttagcagttgccgatgccgatacaattattccaacgattaac
caacttgctgattgttttgaaaatgttgttttgacacaagattggcatcccgataatcat
atatcttttgcacaaaaccattcgggtaagcagccatttgaaaccattgaactcgactat
gggccacaagtgctttggcctaagcattgtgtacagggtactcacgatgccgaatttcat
ccgagtttaaatattccgaccgctcaactgattattcgaaaaggttttcatgctcatatt
gatagctactcggcttttatggaagcagaccatgccacaatgacgggtttaacgggttac
ttaaaagaacgcggtattgatacggtttatgtggtcggaattgccacggacttttgtgtg
gcatggactgccttagatgcagtgaaacaaggttttaaaactttagtgattgaagatgct
tgtaaagctattgatctggatggctcgttagaacacgcttggcaaaccatgcagcaacaa
gaagtagtccgtattcaatcgactgatctgttgagtgggcgctaa

DBGET integrated database retrieval system