KEGG   Acinetobacter oleivorans: AOLE_00280Help
Entry
AOLE_00280        CDS       T01263                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
acd  Acinetobacter oleivorans
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:acd00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
66679..67323
Genome map
AA seq 214 aa AA seqDB search
MNMNKQPQNAVLIVVDVQNGFTPGGNLAVADADTIIPTINQLADCFENVVLTQDWHPDNH
ISFAQNHSGKQPFETIELDYGPQVLWPKHCVQGTHDAEFHPSLNIPTAQLIIRKGFHAHI
DSYSAFMEADHATMTGLTGYLKERGIDTVYVVGIATDFCVAWTALDAVKQGFKTLVIEDA
CKAIDLDGSLEHAWQTMQQQEVVRIQSTDLLSGR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgaataaacaaccacaaaatgcggttttaatcgtagttgatgtgcaaaatggt
tttacaccgggtggaaatttagcagttgccgatgccgatacaattattccaacgattaac
caacttgctgattgttttgaaaatgttgttttgacacaagattggcatcccgataatcat
atatcttttgcacaaaaccattcgggtaagcagccatttgaaaccattgaactcgactat
gggccacaagtgctttggcctaagcattgtgtacagggtactcacgatgccgaatttcat
ccgagtttaaatattccgaccgctcaactgattattcgaaaaggttttcatgctcatatt
gatagctactcggcttttatggaagcagaccatgccacaatgacgggtttaacgggttac
ttaaaagaacgcggtattgatacggtttatgtggtcggaattgccacggacttttgtgtg
gcatggactgccttagatgcagtgaaacaaggttttaaaactttagtgattgaagatgct
tgtaaagctattgatctggatggctcgttagaacacgcttggcaaaccatgcagcaacaa
gaagtagtccgtattcaatcgactgatctgttgagtgggcgctaa

DBGET integrated database retrieval system