KEGG   Acinetobacter oleivorans: AOLE_01220Help
Entry
AOLE_01220        CDS       T01263                                 

Definition
homoserine kinase (EC:2.7.1.39)
Orthology
K02204  
homoserine kinase type II [EC:2.7.1.39]
Organism
acd  Acinetobacter oleivorans
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:acd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AOLE_01220
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AOLE_01220
Enzymes [BR:acd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.39  homoserine kinase
     AOLE_01220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
271072..272022
Genome map
AA seq 316 aa AA seqDB search
MSVYTPLSLDEVRTFAAPYGLEVLELNPIQGGIQNTNYFLVDVNRKQYVLTVFEELDAKG
AGELIPVLEQLGTHDVPVAVPLKHSGQAVHVIADKPAQIAPRLMGHHPMQTTVAQVAAIA
DAQAKLHVALQDFPLEREYRRDHQYWTGVAEQLKPNMSKEDQTLLEQVYQAFNAKTAQYS
NRPTGFIHSDLFRDNTLFEGEQLQGILDFYELNQDELLFDIAITINDFCTEYPAAHLNSD
KVAAYLAAYQKVRVLTSDELECLDVFLAMAACRFWSMRLQVAQKNKEEGRTGDDILQKDP
QEMRAMMQDRLSHVKA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtttataccccgttgagtttagatgaagttcgcacctttgctgcaccttatgga
ttagaggtgttggagctgaacccaattcagggaggtattcaaaacaccaattattttctg
gttgatgtaaaccgcaaacaatatgtacttactgtatttgaagagttagatgcaaaaggg
gcaggtgaacttattcctgtacttgaacaattggggactcatgatgtacccgttgcagta
ccgttaaaacatagcggacaagcggttcatgtgattgcagataagcccgcacagattgca
ccacgtctcatgggtcaccatcccatgcaaaccacagtagcacaagttgcagcaattgca
gatgcacaggcgaaactgcatgtggctttacaagactttccgcttgagcgtgaatatcga
cgcgatcatcaatactggacaggcgttgcagaacagcttaagccaaatatgtctaaagaa
gaccaaacgttacttgagcaggtctatcaagcttttaatgcgaaaacagcgcaatattca
aaccgaccaacaggttttattcactcagatttgttccgtgacaatactttgtttgaaggt
gagcaattacaaggtattttagatttttacgaattaaatcaagatgaattgctatttgat
attgcgattaccatcaatgatttttgtaccgaatatccagcagcacatttaaactcagac
aaagtggcggcttacttagcggcataccaaaaagttcgtgtacttacttcagatgaactt
gagtgtttagatgtattcttggcaatggcagcatgccgtttttggtcaatgcgtttgcaa
gttgctcaaaaaaataaagaagaaggacgtaccggcgatgacattttgcaaaaagacccg
caggaaatgcgagcaatgatgcaagaccgtttaagtcatgtaaaagcataa

DBGET integrated database retrieval system