KEGG   Acinetobacter oleivorans: AOLE_01220Help
Entry
AOLE_01220        CDS       T01263                                 

Definition
(GenBank) homoserine kinase
  KO
K02204  homoserine kinase type II [EC:2.7.1.39]
Organism
acd  Acinetobacter oleivorans
Pathway
acd00260  Glycine, serine and threonine metabolism
acd01100  Metabolic pathways
acd01110  Biosynthesis of secondary metabolites
acd01120  Microbial metabolism in diverse environments
acd01230  Biosynthesis of amino acids
Module
acd_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:acd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AOLE_01220
Enzymes [BR:acd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.39  homoserine kinase
     AOLE_01220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH Choline_kinase DUF4238
Motif
Other DBs
NCBI-ProteinID: ADI89147
UniProt: D8JLP3
Position
271072..272022
Genome map
AA seq 316 aa AA seqDB search
MSVYTPLSLDEVRTFAAPYGLEVLELNPIQGGIQNTNYFLVDVNRKQYVLTVFEELDAKG
AGELIPVLEQLGTHDVPVAVPLKHSGQAVHVIADKPAQIAPRLMGHHPMQTTVAQVAAIA
DAQAKLHVALQDFPLEREYRRDHQYWTGVAEQLKPNMSKEDQTLLEQVYQAFNAKTAQYS
NRPTGFIHSDLFRDNTLFEGEQLQGILDFYELNQDELLFDIAITINDFCTEYPAAHLNSD
KVAAYLAAYQKVRVLTSDELECLDVFLAMAACRFWSMRLQVAQKNKEEGRTGDDILQKDP
QEMRAMMQDRLSHVKA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtttataccccgttgagtttagatgaagttcgcacctttgctgcaccttatgga
ttagaggtgttggagctgaacccaattcagggaggtattcaaaacaccaattattttctg
gttgatgtaaaccgcaaacaatatgtacttactgtatttgaagagttagatgcaaaaggg
gcaggtgaacttattcctgtacttgaacaattggggactcatgatgtacccgttgcagta
ccgttaaaacatagcggacaagcggttcatgtgattgcagataagcccgcacagattgca
ccacgtctcatgggtcaccatcccatgcaaaccacagtagcacaagttgcagcaattgca
gatgcacaggcgaaactgcatgtggctttacaagactttccgcttgagcgtgaatatcga
cgcgatcatcaatactggacaggcgttgcagaacagcttaagccaaatatgtctaaagaa
gaccaaacgttacttgagcaggtctatcaagcttttaatgcgaaaacagcgcaatattca
aaccgaccaacaggttttattcactcagatttgttccgtgacaatactttgtttgaaggt
gagcaattacaaggtattttagatttttacgaattaaatcaagatgaattgctatttgat
attgcgattaccatcaatgatttttgtaccgaatatccagcagcacatttaaactcagac
aaagtggcggcttacttagcggcataccaaaaagttcgtgtacttacttcagatgaactt
gagtgtttagatgtattcttggcaatggcagcatgccgtttttggtcaatgcgtttgcaa
gttgctcaaaaaaataaagaagaaggacgtaccggcgatgacattttgcaaaaagacccg
caggaaatgcgagcaatgatgcaagaccgtttaagtcatgtaaaagcataa

DBGET integrated database retrieval system