KEGG   Acinetobacter oleivorans: AOLE_01590Help
Entry
AOLE_01590        CDS       T01263                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
acd  Acinetobacter oleivorans
Pathway
acd00230  Purine metabolism
acd01100  Metabolic pathways
Module
acd_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:acd00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AOLE_01590 (gmk)
Enzymes [BR:acd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     AOLE_01590 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 AAA_33 MobB MLD AAA_22 AAA RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ADI89221
UniProt: D8JMA3
Position
complement(353258..353887)
Genome map
AA seq 209 aa AA seqDB search
MSGLLFVVSAASGTGKTSLVKALLDRVSNLHVSVSHTTRGQRPGELDGVHYHFTTKDEFL
DQVNHDGFIEYAEVFGNYYGTSQATVKQQLAQGHDVLLEIDWQGAEQVRKLFPESKQIFI
LPPTQFDLRQRLSNRGTDSVEVIEHRLSCAVEDMQHYTNFDYIIINDDFNKALHEIEAVI
TANRLVLSQQAKRYQTLIQDLITPQPKQE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggtctattgtttgtcgtttctgctgcatcaggaacgggcaaaacatctttggtg
aaagccctgcttgaccgtgtgagcaatttacatgtttcagtctcacatactacccgaggt
caacgtcccggtgaattagatggtgttcactatcacttcactacaaaagatgaatttcta
gaccaagtcaaccatgacggttttattgaatacgctgaagtatttggtaattactatggc
acttctcaagcaactgtaaaacaacagttagctcaaggacacgatgttctacttgaaatt
gattggcaaggtgcagagcaagtacgcaaactttttcctgaatccaagcaaatatttatt
ttaccgccaacacagtttgaccttcgtcagcgtttatctaatcgcggcacagactcagtt
gaagtcattgaacatcgtttaagctgtgcagttgaagatatgcagcattatacgaacttt
gattacatcattattaatgatgactttaataaagccttacatgagattgaagctgtgatc
acagcaaaccgtctagtgctatctcagcaagcgaaacgttatcaaacattaattcaagac
ttgattactcctcaaccaaaacaggaataa

DBGET integrated database retrieval system