KEGG   Acinetobacter oleivorans: AOLE_02885Help
Entry
AOLE_02885        CDS       T01263                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
acd  Acinetobacter oleivorans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:acd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AOLE_02885 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AOLE_02885 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AOLE_02885 (trpA)
Enzymes [BR:acd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AOLE_02885 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
613906..614709
Genome map
AA seq 267 aa AA seqDB search
MSRLATRFEKLKSQQRKALVSYVMAGDPQPQVTVPLLHKMVAAGVDVIELGLPFSDPMAD
GPVIALAAERALAAGTNTLDALNMVKEFREQNQDTPVVLMGYLNPVEVIGYEKFVSHAKE
CGVDGLLLVDLPPEESKEFGAVLKQHDMDQIFLLAPTSTDQRIQHVANQASGFIYYVSLK
GVTGAATLDTAEAAARIQKIKNATDIPVGVGFGISDAASAKAMGSVADAVIVGSAFVKNF
ATLAADDAVEQTVNKVKELRAALDELV
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtcttgccacccgttttgaaaagcttaagtcccaacaacgtaaagcgcttgta
tcttatgtcatggcgggtgatccacaaccgcaagtaacagttccgttactgcataaaatg
gttgcggcaggagtagatgtcattgagcttggtttaccattttcagatccaatggccgat
ggtccagtaattgcgcttgcagctgaacgtgcgcttgcagcagggactaacacattagat
gctcttaatatggtaaaggagttccgtgaacagaatcaggatacacctgttgttttaatg
ggttatctaaatccggttgaagtgattggttacgagaagtttgtttctcatgcgaaagag
tgtggtgtagatggcttattactggtggatttaccgccagaagagtcaaaagagtttggt
gctgtgttgaagcaacatgacatggatcaaatcttcttgctcgcaccaacttctacagac
caacgcattcaacatgtggcaaatcaggcaagtggatttatctactatgtttcacttaag
ggtgtaacgggagccgcaacactagatacggcagaagctgctgcacgtattcaaaaaatc
aaaaatgccactgatattccagtaggtgttggttttggtattagtgatgcggcttcagca
aaagcaatgggtagcgttgctgatgctgtgattgtaggtagtgctttcgttaaaaatttt
gcaacgttggcagcggatgacgctgttgaacagacggtgaataaagtcaaggagcttcga
gcagcgctcgatgagttagtatga

DBGET integrated database retrieval system