KEGG   Acinetobacter oleivorans: AOLE_02960Help
Entry
AOLE_02960        CDS       T01263                                 

Definition
(GenBank) putative 3-hydroxybutyryl-CoA epimerase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
acd  Acinetobacter oleivorans
Pathway
acd00071  Fatty acid degradation
acd00280  Valine, leucine and isoleucine degradation
acd00281  Geraniol degradation
acd00310  Lysine degradation
acd00362  Benzoate degradation
acd00380  Tryptophan metabolism
acd00410  beta-Alanine metabolism
acd00640  Propanoate metabolism
acd00650  Butanoate metabolism
acd00903  Limonene and pinene degradation
acd00930  Caprolactam degradation
acd01040  Biosynthesis of unsaturated fatty acids
acd01100  Metabolic pathways
acd01110  Biosynthesis of secondary metabolites
acd01120  Microbial metabolism in diverse environments
acd01130  Biosynthesis of antibiotics
acd01200  Carbon metabolism
acd01212  Fatty acid metabolism
Module
acd_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:acd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AOLE_02960
   00650 Butanoate metabolism
    AOLE_02960
  Lipid metabolism
   00071 Fatty acid degradation
    AOLE_02960
   01040 Biosynthesis of unsaturated fatty acids
    AOLE_02960
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AOLE_02960
   00310 Lysine degradation
    AOLE_02960
   00380 Tryptophan metabolism
    AOLE_02960
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AOLE_02960
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AOLE_02960
   00281 Geraniol degradation
    AOLE_02960
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AOLE_02960
   00930 Caprolactam degradation
    AOLE_02960
Enzymes [BR:acd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     AOLE_02960
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AOLE_02960
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     AOLE_02960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 AlaDh_PNT_C F420_oxidored DUF5333 Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: ADI89493
UniProt: D8JNU6
Position
complement(629369..631504)
Genome map
AA seq 711 aa AA seqDB search
MSAIQYEKNADNIVILTLDSTGQSANTMNAEFRDSLDEATQKLKAETELSGVIFRSAKKT
FFAGGDLDELIQVQPEHATDFFNMVEKLKGHLRTIETLGIPVVAALNGTALGGGWEIALS
CHHRIAINDPKSKFGLPEVTLGLLPGGGGIVRMVRLLGLQNAFPFLMEGKQFGVDKAKSL
GLIHDTAENEQELLDKAIAWVKANPKYQQPFDVKGYKIPGGDPKTPAVAQVLAIAPAMLR
DKTKGCYPAPEAIMAAAVEGAQVDVDTALRIESRYFTQLTTGQISKNMIGTFWHGLNAIK
SGASRPADVTKWQATKVGVLGAGMMGAGIAYSTAIKGIPVVLKDVSVENAEKGKAYSQKL
LDKRVSQGRMTAEKRDQVLSLITATASAQDLQGCDLIIEAVFENQELKAKVTQEAEQYLA
PNGVMASNTSTLPITGLAQASKDDKAFIGLHFFSPVDKMQLVEIIKGKNTSAETLAKAYD
FVQQIGKTPIVVNDSRGFFTSRVFGTFIQEGMRLLAEGVHPARIEMAALKAGMPVGPLAI
QDEVSLTLTEHVASEARKALQAEGKDLPKTSVDEVVHTMIHELNRKGKAAGAGFYDYPEN
GKKHLWEGLNRWQKDHDISEQDMIDRILFVQALDTLRCYEEGVLESVIDANVGSIFGIGY
APWTGGAIQFLNQYGTDKAQKRAEELAAKYGERFTPPALLKTKAEQKQNIQ
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcaattcaatacgaaaaaaatgccgacaatattgtcattttaacgcttgattca
acaggtcaatctgcgaataccatgaatgccgagttccgtgactcgctcgatgaggcaact
cagaaacttaaagcagaaacagaactttcaggtgttattttccgctcagctaaaaaaact
ttctttgcaggcggtgacctagatgagctgattcaagttcagcctgaacatgcaacagac
tttttcaatatggttgaaaagttaaaaggtcatttacgcacaattgaaacgctaggcatt
ccagtcgttgcagcattaaatggcactgcacttggcggtggttgggaaatcgcattaagt
tgccatcaccgtatcgcaatcaatgacccaaaaagtaagttcggcctacctgaagtcact
ttaggcctgttaccgggtggcggtggtattgtccgcatggtacgcctacttggcttacaa
aacgcgtttccatttttaatggaaggcaaacagttcggtgtcgataaagcaaaatcttta
ggcttaattcatgacacagctgaaaatgaacaagagcttttagataaagcaattgcttgg
gtaaaagcgaatccaaaatatcaacagccttttgatgtgaagggttataaaatcccgggt
ggtgatccaaaaacgccagcagttgcacaagttcttgcaattgccccagccatgttaaga
gacaaaaccaaaggttgttatcctgcccctgaagcgattatggctgccgcagttgaaggc
gctcaagttgatgtcgatactgcactgcgtattgagtctcgctactttactcagcttaca
acaggccaaatttctaaaaatatgatcggcactttctggcatggtctaaatgcaattaag
tctggtgcgagccgccctgccgacgttacaaaatggcaagccactaaagttggtgtgttg
ggtgcgggcatgatgggtgcgggcattgcttattcaacagccattaaaggtattccagtt
gtccttaaagatgtatctgttgaaaatgcggagaaaggcaaagcatattcacaaaagctt
cttgataaacgtgtttcacaaggccgtatgactgcagaaaaacgtgatcaggttttatcg
ctcattacggctacagcatcagctcaagatcttcaaggctgtgacttaattattgaagcg
gtatttgaaaatcaagaactcaaagccaaagtcactcaagaagctgaacaatatttagcg
cctaatggcgtaatggcatccaacacctcaaccctgccaattacaggtttagctcaagca
agtaaggatgataaagcttttatcggtctgcacttctttagccctgtcgacaaaatgcag
ttggttgagattattaaaggtaaaaacacctccgcagagactcttgctaaagcctacgac
tttgtacaacaaattggaaaaacaccgattgttgtcaatgatagccgtggtttctttacg
agtcgtgtatttggtacgttcattcaagaaggtatgcgtttgcttgcagagggtgttcac
ccagcacgtattgaaatggcagcactgaaagctggtatgccagttggcccactcgctatt
caagatgaagtgtctttaaccttaactgaacatgttgctagtgaagcacgtaaagccctg
caagctgaaggaaaagatttacctaagacttctgtagatgaagtggttcacaccatgatt
catgagttaaaccgtaaaggcaaagctgctggagctggtttctatgactatccggaaaat
ggtaaaaagcacctttgggaaggcttgaaccgctggcaaaaagatcatgatatttctgaa
caagacatgattgatcgcattctgtttgtacaggcactagataccttacgttgttatgaa
gaaggcgtattagagtctgtaattgatgccaatgtcggttctatctttgggattggttat
gcaccttggacgggaggagcaattcaattcctaaatcaatacggcactgataaagcacaa
aaacgagctgaagagttagctgctaaatatggtgaacgcttcacaccgcctgcactgcta
aaaaccaaagctgagcagaaacaaaatattcaataa

DBGET integrated database retrieval system