KEGG   Acinetobacter oleivorans: AOLE_03690Help
Entry
AOLE_03690        CDS       T01263                                 

Definition
succinate dehydrogenase cytochrome b556 small membrane subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
acd  Acinetobacter oleivorans
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:acd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AOLE_03690
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AOLE_03690
   00650 Butanoate metabolism
    AOLE_03690
  Energy metabolism
   00190 Oxidative phosphorylation
    AOLE_03690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
791042..791407
Genome map
AA seq 121 aa AA seqDB search
MKSATGLTGSGSRDWFIQRVSAVVLAAYTVVLLGWILCKGGFDYQQWAGFMMTLPMKIFS
LLAILSLIAHAWIGMWQVFTDYVTTRQMGPSAKGLRLVLTTAVIIAVFVYAIWGIQIFWA
N
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtgctacaggtttaactggttcaggttctcgtgattggtttatccagcgtgta
agtgcggttgtacttgcagcctatactgttgttcttttgggttggattctctgcaaaggt
ggatttgactatcaacaatgggctggtttcatgatgacattaccaatgaagattttctct
ttattggcaattttatcgcttatcgcacacgcatggattggtatgtggcaagtttttact
gactatgtcactactcgtcaaatgggtccttcagcgaaaggtttacgccttgtactgacg
acggctgtcattattgcagtgtttgtgtacgcaatctggggtatccagattttctgggcg
aattga

DBGET integrated database retrieval system