KEGG   Acinetobacter oleivorans: AOLE_03720Help
Entry
AOLE_03720        CDS       T01263                                 

Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
acd  Acinetobacter oleivorans
Pathway
acd00020  Citrate cycle (TCA cycle)
acd00310  Lysine degradation
acd01100  Metabolic pathways
acd01110  Biosynthesis of secondary metabolites
acd01120  Microbial metabolism in diverse environments
acd01130  Biosynthesis of antibiotics
acd01200  Carbon metabolism
Module
acd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
acd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:acd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AOLE_03720
  Amino acid metabolism
   00310 Lysine degradation
    AOLE_03720
Enzymes [BR:acd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AOLE_03720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: ADI89643
UniProt: D8JDK6
Position
797390..798580
Genome map
AA seq 396 aa AA seqDB search
MATEIKAPVFPESVADGTIATWHKKVGEPVSRDEVICDIETDKVVLEVVAPADGSLVAII
KGEGDTVLSDEVIAQFEAGAGAAAAPAVEQAVAQTQAGAAPVVERTEAVSGQAPAVRKAL
SETGIAAADVQGTGRGGRITKEDVANHQAKPAANVTPLSVAVGERIEKRVPMTRLRKRVA
ERLLSATQETAMLTTFNEVNMKPIMELRKQYKDAFEKRHGARLGFMSFFVKAVTEALKRY
PAVNASIDGDDIVYHGYYDIGVAVSSDRGLVVPVLRDTDRMSYAEVEAGIGAYAAKARDG
KLSIEEMTGGTFTITNGGTFGSLLSTPILNQPQTGILGMHKIQERPMAVNGQVEILPMMY
LALSYDHRMIDGKEAVGFLVAIKELLEEPAKLILDL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgaaattaaagcaccggtattcccagagtctgttgcagatggaaccatcgca
acttggcacaaaaaggtgggtgaacctgtatcacgtgacgaagtgatctgtgatattgaa
accgacaaagttgttttagaagtggttgctcctgcagatggtagcttagttgcaatcatt
aaaggtgaaggcgatacagttctttctgacgaagtgattgctcagtttgaagctggtgct
ggtgcggcagctgctcctgcagtagagcaagcagttgctcaaactcaagctggtgcagct
cctgttgttgagcgcactgaagctgtatctggtcaagctcctgcagttcgtaaagctttg
tctgaaacaggtattgctgctgctgacgtacaaggtactggtcgcggtggtcgtatcact
aaagaagatgtagcaaaccatcaagctaaaccagctgctaacgttactccgttaagcgta
gctgttggtgagcgcatcgaaaaacgcgttccaatgactcgtttacgtaagcgtgtagct
gagcgtcttctttctgcaactcaagaaactgcaatgttaactacatttaacgaagttaac
atgaagccaatcatggaattgcgtaagcaatataaagatgcgtttgaaaaacgccatggc
gctcgtttgggcttcatgtcattctttgttaaagctgtaactgaagcacttaaacgctat
cctgcggtaaatgcgtcaattgatggcgacgatattgtttatcacggttactatgacatc
ggtgttgcagtatcttctgatcgtggtcttgttgtaccagtattacgtgatactgatcgt
atgagctacgcagaagttgaagctggtattggtgcttatgctgctaaagcacgtgacggt
aaattatctatcgaagaaatgactggtggtactttcactattactaatggtggtactttc
ggttcattactttcaactccaattttgaatcagccgcaaactggtatcttgggtatgcac
aaaatccaagagcgtcctatggctgtaaatggtcaagttgaaatcttgccaatgatgtat
ttagcgctttcttacgaccaccgtatgatcgatggtaaagaagcagtaggtttcttggta
gcaatcaaagaattgttagaagagccagctaaactcatccttgatctttaa

DBGET integrated database retrieval system