KEGG   Acinetobacter oleivorans: AOLE_05250Help
Entry
AOLE_05250        CDS       T01263                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
acd  Acinetobacter oleivorans
Pathway
acd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
acd01100  Metabolic pathways
acd01110  Biosynthesis of secondary metabolites
acd01130  Biosynthesis of antibiotics
acd01230  Biosynthesis of amino acids
Module
acd_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:acd00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AOLE_05250 (trpC)
Enzymes [BR:acd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     AOLE_05250 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADI89947
UniProt: D8JF81
Position
complement(1149891..1150697)
Genome map
AA seq 268 aa AA seqDB search
MINIQNTILGKIVDRKHEELAARLKQRNLQDVEELAKAATPVRGFANALKHKRPGVIAEI
KKASPSKGIIRADFNPAEIAEQYEQAGAACLSVLTDVDFFQGADENIAIARNHCALPALR
KDFLIDPYNVVEARALHADCILLIVACLSDQQLEEMSKTAFEHQLDVLVEVHDEEEMERA
LKLSEQCLLGVNNRNLKTFDVDLNTSIRLKKLLPASRLLITESGIATPDDVRMMQEHDIH
SFLVGESFMKQPRPDQAFTALFGQPQTV
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgattaatattcaaaataccattttaggtaaaattgttgaccgtaaacatgaggaactt
gctgcgcgtttaaaacaacgtaatttgcaagatgttgaggaattagcaaaagctgcgact
ccagtgcgtggctttgcaaatgctttaaaacataaacgtccgggtgtaattgctgaaatt
aaaaaagcgtctccatcaaaaggaattattcgcgcagattttaatcctgctgaaattgca
gagcaatatgaacaagctggagcagcatgtttatcggtattgaccgatgttgatttcttt
caaggtgcagatgagaatattgcgattgcccgtaatcattgtgccctgcctgctttacgt
aaagactttctgatcgatccatataatgtagttgaagcacgtgctttgcatgctgactgt
attttattaattgttgcttgcttatctgaccagcaactcgaagaaatgtctaaaactgcg
tttgaacatcaactcgatgtattagttgaagttcatgacgaagaagaaatggaacgcgct
ttaaagctttctgagcaatgtttattaggtgtgaataaccgtaatttaaaaacgtttgat
gtggatttaaatacatccattcgattgaaaaaattacttccggcctcacgtttattaatt
actgaaagcggtattgcgacaccagatgatgtgcgtatgatgcaagagcatgatattcac
agtttcttggtaggcgaaagttttatgaaacaaccacgtccagatcaagcttttactgct
ctttttggacaacctcaaacggtttaa

DBGET integrated database retrieval system