KEGG   Acinetobacter oleivorans: AOLE_06790Help
Entry
AOLE_06790        CDS       T01263                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
acd  Acinetobacter oleivorans
Brite
Enzymes [BR:acd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     AOLE_06790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1482808..1483380
Genome map
AA seq 190 aa AA seqDB search
MQKILDYLRKFFTAKPQQDAAVDQIATATDYGDELIGVAVDEMSLSLEGVNLICNFEGLK
LSAYDDGTGVWTIGYGTTRYPNGQRVSERDRCTLEQAKAYMQHDLKIFERAVNSVVKVPL
KQNQFDALVSLAYNIGVGAFKNSTLLKNLNLGDYKEAGNQFDVWVNAGGKRLQGLVNRRA
IEKKLFLSPK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaatattggattatctccgcaaattttttactgctaagcctcagcaagatgca
gcagtggatcagattgctacagcaactgattatggtgatgaattgataggtgtcgctgtt
gatgagatgtctcttagtttagaaggtgtaaacctaatttgtaattttgaaggattaaaa
cttagtgcttatgacgatggtactggggtatggactattggatatggcacgacgcgatat
cctaatggccagcgtgtaagtgaaagagaccgatgcacacttgaacaggctaaagcttat
atgcagcatgatttaaagatatttgagcgcgcagtaaatagtgttgtaaaagtgccttta
aaacagaatcaattcgatgcattagtctctttagcttataacattggagttggggctttt
aaaaattcgaccttactcaaaaatttaaatttaggtgattataaagaggctggaaaccag
tttgatgtctgggtcaatgctggtggtaagcggttgcaggggctagtgaatcgccgagca
atcgaaaagaaattatttttatcgccaaaatag

DBGET integrated database retrieval system