KEGG   Acinetobacter oleivorans: AOLE_08230Help
Entry
AOLE_08230        CDS       T01263                                 

Definition
(GenBank) phospholipase
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
acd  Acinetobacter oleivorans
Pathway
acd00564  Glycerophospholipid metabolism
acd00565  Ether lipid metabolism
acd00590  Arachidonic acid metabolism
acd00591  Linoleic acid metabolism
acd00592  alpha-Linolenic acid metabolism
acd01100  Metabolic pathways
acd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acd00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AOLE_08230
   00565 Ether lipid metabolism
    AOLE_08230
   00590 Arachidonic acid metabolism
    AOLE_08230
   00591 Linoleic acid metabolism
    AOLE_08230
   00592 alpha-Linolenic acid metabolism
    AOLE_08230
Enzymes [BR:acd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     AOLE_08230
    3.1.1.32  phospholipase A1
     AOLE_08230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1 VasI
Motif
Other DBs
NCBI-ProteinID: ADI90535
UniProt: D8JIS2
Position
1766320..1767471
Genome map
AA seq 383 aa AA seqDB search
MAFRQFERTSLQLSMGIVLSCLCASVTYADTLAPVTPATVDACVALASNADRLACYDSVF
KPSALPVIQAAAVPEPVKKIDAPAVPPETFKEKVVDTVSNIKIIGKAPKLQPTTSLLDQR
WELSEESKLGVWNIRAYQPVYLLPVFWTSDKNELPTSPNPNNVEHTAQNLKSTESKFQIS
LKTKAWENIFGNNGDLWVGYTQSSRWQTFNAEESRPFRETNYEPEASLMFRTNYELLGLD
GRLLGVTLNHQSNGRSDPLSRSWNRVIFNVGLERGNFAVMLRPWIRLEEDSKDDNNPDIE
DYVGRGDLTAFYKWKQNDFSLMLRHSLKGGDDSHGAVQFDWAFPISGKLRGHFQLFNGYG
ESLIDYNHRATYAGLGVSLMNWY
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcagacaatttgaacgcacatctttacagctaagcatgggaatcgtgcttagc
tgtttgtgtgcgtctgtgacatatgctgacaccttggcacctgtaacccccgcgacagta
gatgcatgtgttgctcttgcttcgaatgccgatcgtctggcttgttatgactctgtattt
aaaccgtcagctttaccagttattcaagctgcggctgtaccagagcctgttaaaaaaatt
gatgcacctgctgttccacctgaaacctttaaagagaaggtggtagatacagtgagtaat
atcaaaataattggcaaagccccaaaacttcaacctactacctctctgctagatcaacgt
tgggagctatctgaagagagtaaattaggggtttggaatattcgtgcttatcagcctgtc
tatttactacctgtattctggaccagtgataaaaatgaattacctactagcccaaatcca
aacaatgtagaacatacagcccaaaatctgaaatcaacagaaagtaaatttcagatttct
ttaaagaccaaagcttgggaaaatatttttggtaataatggtgatttgtgggtaggttat
acccaatcttcacgttggcagacatttaatgcagaagagtctcgtcctttccgtgaaacg
aattatgagcctgaagcaagtttaatgtttagaacaaactatgaattgcttggtttagat
gggcgtttgcttggggttactttaaaccaccaatcaaatggtcgttcagatccattatct
cgtagctggaaccgtgtgatttttaacgttgggttagagcgcggtaactttgctgtaatg
cttcgtccatggattcgtctggaagaagacagcaaagatgataataaccccgatattgaa
gattacgttggtcgtggtgatttaacagcattttataagtggaagcagaatgatttctct
ttaatgctgcgtcattcactgaaaggcggtgatgattctcatggcgcagttcaatttgat
tgggcttttccaatcagtggcaaactgcgtggacacttccagttgtttaatggttacggt
gaaagcttaattgactataatcaccgagcaacctacgcgggcttgggtgtttcactcatg
aactggtactaa

DBGET integrated database retrieval system