KEGG   Acinetobacter oleivorans: AOLE_08445Help
Entry
AOLE_08445        CDS       T01263                                 

Definition
(GenBank) Porin B precursor
  KO
K07267  
porin
Organism
acd  Acinetobacter oleivorans
Brite
Transporters [BR:acd02000]
 Other Transporters
  Pores ion channels [TC:1]
   AOLE_08445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1810495..1811814
Genome map
AA seq 439 aa AA seqDB search
MPNIMKLSVLTIAVLGSQFALANEPWSQDRQWLLGDWNGERQQLEQQGYKFTASIMSQSA
TNLDGGYNDSNTFENAAQLSLGANFDLEKIAGWKDTTASLVVTKRDGNALTLERIKDPRS
SQLGNAQEIYGRGKIWRLSQAWVKKGFVDNTIQAKVGRMGMSEDFNSSQCEFQNLLLCGG
QLGKSIGSIWYNSPVGVWAANVKYQFAPEWTLGVGVYEVNPDNIKTESNSDGFNLDMNNV
KGATIPVELAWKPKLAAFNGLPGEYKVGALYSTAEANDIKTAGKVHDGKQSFWINAQQQL
TNNGQDPKRGLYVSFNGVVNDKATTFVQSTQQLALWYKGPFDSRPNDSIGFGIANYLVND
RAKDKQIATNESRGYYSYDAIASDYIPIQDDELNVELNYTYQWSPAVMLRPNIQYIHQPA
GVKAVDDAWVAGLSVKVNF
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatataatgaaactgagtgtgttaacaatcgcagtattaggcagtcaatttgca
cttgctaatgagccttggtcacaagaccgtcaatggttgctaggcgactggaatggtgag
cgccagcagctagaacaacagggctataaatttacagcttctattatgagccaaagtgcc
acaaatttagatggtggttacaacgacagcaatacttttgaaaatgctgcgcaactttct
ttaggtgcaaacttcgatttagaaaagattgctgggtggaaagatacaacagcgagtcta
gtcgtgactaaacgtgacggaaatgcgcttactttggagcgtattaaagacccgcgttct
agccaattaggtaatgctcaagagatttatggccgcggtaaaatctggcgtctgtctcaa
gcatgggtaaagaaaggctttgttgataatactatacaggccaaagttggccgtatgggc
atgtcagaagacttcaatagttctcaatgtgagtttcagaacttattgctttgcggtggg
cagctaggaaaatcaattggttcaatttggtacaactcaccagttggtgtttgggctgca
aacgttaaatatcaatttgcgcctgagtggactttgggtgtcggtgtttatgaagtaaat
ccagacaacattaaaaccgaatcaaatagtgatggttttaatctggatatgaacaacgtg
aagggtgcaaccataccagttgagctcgcatggaaaccaaaacttgctgcttttaatggt
ttaccgggtgaatataaagtaggtgcgctgtactcaaccgcagaagcaaatgatattaaa
actgcggggaaggttcatgacggaaaacaaagtttctggattaatgcacaacaacaactg
acgaataacggccaagatccgaaacgcggtttatatgtaagttttaatggcgttgtaaat
gataaggcaacgacctttgttcaaagtacccaacaacttgctctttggtataaagggcca
tttgatagccgtccaaatgattcgattggttttggtattgccaattatttggtcaatgat
cgtgctaaagataagcaaatcgcaactaacgaaagtcgtggatattatagctatgatgcg
attgcatctgactatattccaattcaagacgacgagctaaatgtcgaattgaactatacc
tatcaatggtctccggccgttatgttacgtccaaacattcaatatatccatcaacctgct
ggtgtaaaagcggtcgatgatgcttgggtggcgggcttaagcgttaaagtcaatttttaa

DBGET integrated database retrieval system