KEGG   Acinetobacter oleivorans: AOLE_08445Help
Entry
AOLE_08445        CDS       T01263                                 

Definition
Porin B
Orthology
K07267  
porin
Organism
acd  Acinetobacter oleivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1810495..1811814
Genome map
AA seq 439 aa AA seqDB search
MPNIMKLSVLTIAVLGSQFALANEPWSQDRQWLLGDWNGERQQLEQQGYKFTASIMSQSA
TNLDGGYNDSNTFENAAQLSLGANFDLEKIAGWKDTTASLVVTKRDGNALTLERIKDPRS
SQLGNAQEIYGRGKIWRLSQAWVKKGFVDNTIQAKVGRMGMSEDFNSSQCEFQNLLLCGG
QLGKSIGSIWYNSPVGVWAANVKYQFAPEWTLGVGVYEVNPDNIKTESNSDGFNLDMNNV
KGATIPVELAWKPKLAAFNGLPGEYKVGALYSTAEANDIKTAGKVHDGKQSFWINAQQQL
TNNGQDPKRGLYVSFNGVVNDKATTFVQSTQQLALWYKGPFDSRPNDSIGFGIANYLVND
RAKDKQIATNESRGYYSYDAIASDYIPIQDDELNVELNYTYQWSPAVMLRPNIQYIHQPA
GVKAVDDAWVAGLSVKVNF
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatataatgaaactgagtgtgttaacaatcgcagtattaggcagtcaatttgca
cttgctaatgagccttggtcacaagaccgtcaatggttgctaggcgactggaatggtgag
cgccagcagctagaacaacagggctataaatttacagcttctattatgagccaaagtgcc
acaaatttagatggtggttacaacgacagcaatacttttgaaaatgctgcgcaactttct
ttaggtgcaaacttcgatttagaaaagattgctgggtggaaagatacaacagcgagtcta
gtcgtgactaaacgtgacggaaatgcgcttactttggagcgtattaaagacccgcgttct
agccaattaggtaatgctcaagagatttatggccgcggtaaaatctggcgtctgtctcaa
gcatgggtaaagaaaggctttgttgataatactatacaggccaaagttggccgtatgggc
atgtcagaagacttcaatagttctcaatgtgagtttcagaacttattgctttgcggtggg
cagctaggaaaatcaattggttcaatttggtacaactcaccagttggtgtttgggctgca
aacgttaaatatcaatttgcgcctgagtggactttgggtgtcggtgtttatgaagtaaat
ccagacaacattaaaaccgaatcaaatagtgatggttttaatctggatatgaacaacgtg
aagggtgcaaccataccagttgagctcgcatggaaaccaaaacttgctgcttttaatggt
ttaccgggtgaatataaagtaggtgcgctgtactcaaccgcagaagcaaatgatattaaa
actgcggggaaggttcatgacggaaaacaaagtttctggattaatgcacaacaacaactg
acgaataacggccaagatccgaaacgcggtttatatgtaagttttaatggcgttgtaaat
gataaggcaacgacctttgttcaaagtacccaacaacttgctctttggtataaagggcca
tttgatagccgtccaaatgattcgattggttttggtattgccaattatttggtcaatgat
cgtgctaaagataagcaaatcgcaactaacgaaagtcgtggatattatagctatgatgcg
attgcatctgactatattccaattcaagacgacgagctaaatgtcgaattgaactatacc
tatcaatggtctccggccgttatgttacgtccaaacattcaatatatccatcaacctgct
ggtgtaaaagcggtcgatgatgcttgggtggcgggcttaagcgttaaagtcaatttttaa

DBGET integrated database retrieval system