KEGG   Acinetobacter oleivorans: AOLE_08915Help
Entry
AOLE_08915        CDS       T01263                                 

Definition
glucose-methanol-choline oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
acd  Acinetobacter oleivorans
Brite
KEGG Orthology (KO) [BR:acd00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    AOLE_08915
Enzymes [BR:acd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     AOLE_08915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1912029..1913633
Genome map
AA seq 534 aa AA seqDB search
MRNTSSDSPLFDYDWVVIGSGFGGSVSALRLAEKGYRVAVLERGKRYKDEDLPKSTWQLS
KFLWVPSIGWKGIMRMKIFRHVFFPSQSAVGGGSTVYGGVLYRARPEFFKNPQWNHLRDD
WQQVLTPFYDKAEYMLGVETVEFDSTNQNIAKEMAARFGCSDGFKRAPTGVFFGEPGKKV
PDPYFGGEGPERTGCIRCGACMVGCRVGAVNSLSKNYLWFAEKKGVQIFPEHQVTDIKPL
NASDGSDGYRVTVQTKGLFFTKKITFSTKGVVFAGGALGTNELLANCKLNGSLPNISNKL
GQLVRTNSESVLNVRLPKDLKTWNDVTASSSVHIDQNTHIEFLTYGRHADFMSLMYTVLV
GNGNRLTRPLKWLWQIVRHPAQWLKTVSPIGWSQHMITLLVMQSLDNSIQFLPKKRWFGS
GYKLITKQNSDKPNPTYIDIANQAAQWVADYTGGVAQSNILEAIADIPTTAHVLGGAVIG
KDAAHGVIDHNLQIFGYKNLLVCDGSAMPANPGVNPALTITALAEYAMSKVIEP
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaacacttcttctgacagcccattatttgattacgactgggtagttataggttct
ggttttggtggtagcgtttctgccttacgcttagctgaaaaaggctatcgagttgccgta
ttagagcgtggaaaacgctataaagatgaggacttgcctaaatcgacttggcaactcagt
aaatttttatgggtaccttcaattggatggaaaggaatcatgcgaatgaagatttttcgc
catgttttttttcccagtcaatctgctgttggtggcggtagtacggtttatggtggagtt
ctctatcgggctaggccagagttctttaaaaatcctcagtggaatcatcttagggatgat
tggcaacaggtcttaacgccattttacgataaagccgaatatatgctgggcgtagagact
gttgagtttgattctacaaatcaaaatattgcaaaagaaatggcagctcgttttggttgt
agtgatggatttaagcgtgcaccgacaggtgtttttttcggtgagccaggcaaaaaagtg
cctgatccttattttggaggtgaaggtccagagcgtacaggatgtattcgctgtggcgca
tgtatggttggttgtcgggtcggagcagtaaactcattaagtaaaaattatttatggttt
gctgaaaagaaaggtgttcaaatttttccagaacatcaagtcactgatattaaaccttta
aatgcatcagatggaagtgatggctatcgcgttacagttcaaacaaaagggttgttcttt
actaaaaaaattacgttttcgactaaaggtgtcgtgtttgcaggaggcgcactgggaacc
aatgaattattagccaattgtaaattgaatggttcactaccgaatatcagcaataaattg
ggacaattggtgcgtaccaatagtgaatctgtgcttaatgtaagattgcccaaagatcta
aaaacgtggaatgacgttactgcaagtagcagtgtacatattgatcaaaacacacatatt
gagtttttgacctatgggcgacatgcggactttatgagtttgatgtataccgttttagtg
ggtaacggaaatcgattaacacgcccactcaaatggttgtggcaaattgtgcggcatccg
gcacaatggctgaaaacagtgtcacctattgggtggagtcagcacatgattacgttgttg
gtaatgcaatctctagataactcaatccaatttttacctaaaaagcgttggtttggttct
ggatataaattaattactaagcagaatagtgataagccaaatccaacatacattgatatt
gcaaatcaggctgcacagtgggtagctgattatacaggtggtgttgcgcagagtaatatt
ttagaagcaatagctgatatcccgacgacagcacatgttttaggtggggctgtcattgga
aaagatgctgctcacggtgtgattgatcataatttacaaatatttggatataaaaactta
ttggtttgtgacggatcagcaatgccagcaaatcctggggtaaatccagctttaacaatt
actgctttagctgaatatgcaatgtctaaagtaatagaaccctag

DBGET integrated database retrieval system